AHR Recombinant Protein Antigen

Images

 
There are currently no images for AHR Protein (NBP1-89974PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

AHR Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AHR.

Source: E. coli

Amino Acid Sequence: NWQDNTAPMGNDTILKHEQIDQPQDVNSFAGGHPGLFQDSKNSDLYSIMKNLGIDFEDIRHMQNEKFFRNDFSGEVDFRDIDLTDEI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
AHR
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89974.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for AHR Recombinant Protein Antigen

  • Ah receptor
  • AHR
  • AH-receptor
  • aryl hydrocarbon receptor
  • BHLHE76
  • bHLHe76aromatic hydrocarbon receptor
  • Class E basic helix-loop-helix protein 76

Background

Aryl hydrocarbon receptor (AHR) is a member of the basic-helix-loop-helix transcription factor protein family that is a normally inactive cytosolic transcription factor. Upon ligand binding AhR translocates to the nucleus and dimerizes with the AhR nuclear translocator (ARNT), leading to gene transcription alterations.

AHR is expressed in all tissues and most likely plays an important role in the development and maturation of many tissues.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74398
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-124
Species: Bv, Ma, Hu, Mu, Pm, Rt, Sh
Applications: ChIP, CHIP-SEQ, GS, IB, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-24722
Species: Hu
Applications: IHC,  IHC-P, In vitro, WB
NBP2-02563
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB600-922
Species: Ch, Mu
Applications: ELISA, IHC, Single-Cell Western, WB
PP-H4417-00
Species: Hu
Applications: DirELISA, IP, WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr,  IHC-P, WB
DY413
Species: Mu
Applications: ELISA
PP-N4111-00
Species: Hu
Applications: IHC, IP, WB
6507-IL/CF
Species: Hu
Applications: BA
NBP2-48615
Species: Hu
Applications: IHC,  IHC-P, WB
M5000
Species: Mu
Applications: ELISA
NBP1-32822
Species: Al, Av, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, Flow, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NBP3-41281
Species: Hu
Applications: WB
M6000B
Species: Mu
Applications: ELISA
NBP1-59786
Species: Hu
Applications: WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
DY417
Species: Mu
Applications: ELISA
NBP1-37003
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, PEP-ELISA

Publications for AHR Protein (NBP1-89974PEP) (0)

There are no publications for AHR Protein (NBP1-89974PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AHR Protein (NBP1-89974PEP) (0)

There are no reviews for AHR Protein (NBP1-89974PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for AHR Protein (NBP1-89974PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional AHR Products

Research Areas for AHR Protein (NBP1-89974PEP)

Find related products by research area.

Blogs on AHR.

AHR - A transcription factor regulating immunity and tumorigenesis
The aryl hydrocarbon receptor (AHR) is a ligand activated transcription factor that controls the expression of a diverse set of genes. In the absence of ligand, AHR is retained in the cytoplasm. Upon ligand binding AHR translocates to the nucleus w...  Read full blog post.

Aryl Hydrocarbon Signaling: AIP, AhR, ARNT, BMAL1 and more...
AH receptor-interacting protein (AIP) is a 37 kD immunophilin-like factor found in a variety of tissues with expression levels ranging from high (spleen, thymus, pituitary heart, placenta and skeletal muscle) to low (liver, kidney and lung). It mediat...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our AHR Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol AHR