AHR Antibody (3B12)

Images

 
Western Blot: AHR Antibody (3B12) [H00000196-M02] - Analysis of AHR expression in transfected 293T cell line by AHR monoclonal antibody (M02), clone 3B12.Lane 1: AHR transfected lysate(96.147 KDa).Lane 2: ...read more
Immunocytochemistry/ Immunofluorescence: AHR Antibody (3B12) [H00000196-M02] - Analysis of monoclonal antibody to AHR on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: AHR Antibody (3B12) [H00000196-M02] - Analysis of AHR expression in COLO 320 HSR ( Cat # L020V1 ).
Western Blot: AHR Antibody (3B12) [H00000196-M02] - Analysis of AHR over-expressed 293 cell line, cotransfected with AHR Validated Chimera RNAi ( Cat # H00000196-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot ...read more
Immunoprecipitation: AHR Antibody (3B12) [H00000196-M02] - Analysis of AHR transfected lysate using anti-AHR monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with AHR MaxPab rabbit polyclonal antibody.
ELISA: AHR Antibody (3B12) [H00000196-M02] - Detection limit for recombinant GST tagged AHR is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ChIP, ELISA, ICC/IF, IP, KD
Clone
3B12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

AHR Antibody (3B12) Summary

Immunogen
AHR (NP_001612, 721 a.a. ~ 820 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGSFEPSPYPTTSSLEDFVTCLQLPENQKHGLNPQSAIITPQTCYAGAVSMYQCQPEPQHTHVGQMQYNPVLPGQQAFLNKFQNGVLNETYPAELNNINN
Specificity
aryl hydrocarbon receptor
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
AHR
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Chromatin Immunoprecipitation
  • ELISA 0.03ng/ml
  • Immunocytochemistry/Immunofluorescence 20ug/mL
  • Immunoprecipitation 1:10-1:500
  • Knockdown Validated
  • Western Blot 1:500
Application Notes
Antibody reactivity against cell lysate, transfected lysate and recombinant protein for WB. It has been used for IF, RNAi Validation, and ELISA. ChIP usage reported in scientific literature (PMID: 23714156).
Publications
Read Publications using
H00000196-M02 in the following applications:

  • 1 publication
  • IP
    1 publication

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for AHR Antibody (3B12)

  • Ah receptor
  • AHR
  • AH-receptor
  • aryl hydrocarbon receptor
  • BHLHE76
  • bHLHe76aromatic hydrocarbon receptor
  • Class E basic helix-loop-helix protein 76

Background

This gene encodes a ligand-activated transcription factor involved in the regulation of biological responses to planar aromatic hydrocarbons. This receptor has been shown to regulate xenobiotic-metabolizing enzymes such as cytochrome P450. Its ligands included a variety of aromatic hydrocarbons.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74398
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-124
Species: Bv, Ma, Hu, Mu, Pm, Rt, Sh
Applications: CHIP-SEQ, ChIP, GS, IB, ICC/IF, IHC, IHC-P, IP, WB
NBP2-24722
Species: Hu
Applications: IHC, IHC-P, In vitro, WB
NBP2-02563
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB600-922
Species: Ch
Applications: ELISA, IHC, IHC-P, IP, Single-Cell Western, WB
PP-H4417-00
Species: Hu
Applications: DirELISA, IP, WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
M1300CB
Species: Mu
Applications: ELISA
PP-N4111-00
Species: Hu
Applications: IHC, IP, WB
6507-IL/CF
Species: Hu
Applications: BA
NBP2-48615
Species: Hu
Applications: IHC, IHC-P, WB
M5000
Species: Mu
Applications: ELISA
NBP1-32822
Species: Al, Av, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, KD, WB
H00057491-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
D6050
Species: Hu
Applications: ELISA
NBP1-59786
Species: Hu
Applications: WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
DY417
Species: Mu
Applications: ELISA
NBP1-37003
Species: Hu, Pm
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA

Publications for AHR Antibody (H00000196-M02)(5)

Reviews for AHR Antibody (H00000196-M02) (0)

There are no reviews for AHR Antibody (H00000196-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ChIP Video Protocol
ChIP Webinar
ICC/IF Video Protocol

FAQs for AHR Antibody (H00000196-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AHR Products

Bioinformatics Tool for AHR Antibody (H00000196-M02)

Discover related pathways, diseases and genes to AHR Antibody (H00000196-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AHR Antibody (H00000196-M02)

Discover more about diseases related to AHR Antibody (H00000196-M02).
 

Pathways for AHR Antibody (H00000196-M02)

View related products by pathway.

PTMs for AHR Antibody (H00000196-M02)

Learn more about PTMs related to AHR Antibody (H00000196-M02).
 

Research Areas for AHR Antibody (H00000196-M02)

Find related products by research area.

Blogs on AHR.

AHR - A transcription factor regulating immunity and tumorigenesis
The aryl hydrocarbon receptor (AHR) is a ligand activated transcription factor that controls the expression of a diverse set of genes. In the absence of ligand, AHR is retained in the cytoplasm. Upon ligand binding AHR translocates to the nucleus w...  Read full blog post.

Aryl Hydrocarbon Signaling: AIP, AhR, ARNT, BMAL1 and more...
AH receptor-interacting protein (AIP) is a 37 kD immunophilin-like factor found in a variety of tissues with expression levels ranging from high (spleen, thymus, pituitary heart, placenta and skeletal muscle) to low (liver, kidney and lung). It mediat...  Read full blog post.

Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AHR Antibody (3B12) and receive a gift card or discount.

Bioinformatics

Gene Symbol AHR
Entrez
OMIM
Uniprot