AGTR-2 Antibody (0V7Y3)

Western Blot: AGTR-2 Antibody (0V7Y3) [NBP3-16238] - Western blot analysis of extracts of various cell lines, using AGTR-2 Rabbit mAb (NBP3-16238) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1min.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clone: 0V7Y3
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

AGTR-2 Antibody (0V7Y3) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 264-363 of human AGTR-2 (P50052). AFIICWLPFHVLTFLDALAWMGVINSCEVIAVIDLALPFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRESMSCRKSSSLREMETFVS
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: AGTR2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 41 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for AGTR-2 Antibody (0V7Y3)

• AGTR2
• AGTR-2
• Angiostensin Receptor
• angiotensin II receptor, type 2
• Angiotensin II type-2 receptor
• angiotensin receptor 2
• AT2
• AT2ATGR2
• AT2R
• MRX88
• MRX88type-2 angiotensin II receptor

Background

Angiotensin II is a potent pressor hormone and a primary regulator of aldosterone secretion. It is an important effector controlling blood pressure and volume in the cardiovascular system. It acts through at least two types of receptors termed AT1 and AT2. AGTR2 belongs to a family 1 of G-protein coupled receptors. It is an intergral membrane protein. It plays a role in the central nervous system and cardiovascular functions that are mediated by the renin-angiotensin system. This receptor mediates programmed cell death (apoptosis). In adults, it is highly expressed in myometrium with lower levels in adrenal gland and fallopian tube. It is highly expressed in fetal kidney and intestine. The human AGTR2 gene is composed of three exons and spans at least 5 kb. Exons 1 and 2 encode for 5; untranslated mRNA sequence and exon 3 harbors the entire uninterrupted open reading frame.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AGTR2