AGPAT7 Antibody - BSA Free

Immunohistochemistry-Paraffin: AGPAT7 Antibody [NBP3-17567] - Staining of human hippocampus shows moderate cytoplasmic positivity in neuronal cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

AGPAT7 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit AGPAT7 Antibody - BSA Free (NBP3-17567) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ATECEFVGSLPVIVVGRLKVALEPQLWELGKVLRKAGLSAGYVDAGAEPGRSRMISQEEFARQLQLSDPQTVAGAFGYFQQDT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LPCAT4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for AGPAT7 Antibody - BSA Free

• acyltransferase like 3
• Acyltransferase-like 3
• AGPAT7acyl-CoA:lysophosphatidylethanolamine acyltransferase 2
• AYTL3lysophospholipid acyltransferase LPCAT4,1-acylglycerol-3-phosphate O-acyltransferase 7 (lysophosphatidic acidacyltransferase, eta)
• EC 2.3.1
• EC 2.3.1.-
• EC 2.3.1.23
• FLJ10257,1-acylglycerol-3-phosphate O-acyltransferase 7
• LPAAT-eta
• LPEAT21-AGPAT 7
• lysophosphatidylcholine acyltransferase 41-AGP acyltransferase 7
• Lysophosphatidylethanolamine acyltransferase 2
• PLSC domain containing protein

Background

Members of the 1-acylglycerol-3-phosphate O-acyltransferase (EC 2.3.1.51) family, such as AGPAT7, catalyze the conversion of lysophosphatidic acid (LPA) to phosphatidic acid (PA), a precursor in the biosynthesis of all glycerolipids. Both LPA and PA are involved in signal transduction (Ye et al., 2005 [PubMed 16243729]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LPCAT4