LPCAT2 Antibody

Images

 
Western Blot: LPCAT2 Antibody [NBP1-88921] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: LPCAT2 Antibody [NBP1-88921] - Staining of human cell line A-431 shows localization to endoplasmic reticulum & lipid droplets.
Immunohistochemistry-Paraffin: LPCAT2 Antibody [NBP1-88921] - Staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.
Western Blot: LPCAT2 Antibody [NBP1-88921] - Analysis in human thyroid gland tissue.
Immunocytochemistry/ Immunofluorescence: LPCAT2 Antibody [NBP1-88921] - Staining of murine cell line RAW264.7. Image provided by product review by verified customer.
Immunocytochemistry/ Immunofluorescence: LPCAT2 Antibody [NBP1-88921] - Staining of human cell line A-431 shows positivity in endoplasmic reticulum.
Immunohistochemistry-Frozen: LPCAT2 Antibody [NBP1-88921] - Staining of LPCAT2 in rat neuronal tissue using anti-LPCAT2 antibody. Image from verified customer review.

Product Details

Summary
Reactivity Hu, Rt, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-Fr, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LPCAT2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FALFDRNHDGSIDFREYVIGLAVLCNPSNTEEIIQVAFKLFDVDEDGYITEEEFSTILQASLGVPDLDVSGLFKEIAQGDSISYEEFKSFALKHPEYAKIFTTYLDLQTCHVFSLPKEVQTTPSTASNKVSPE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LPCAT2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
LPCAT2 Protein (NBP1-88921PEP)
Reviewed Applications
Read 2 Reviews rated 4.5
using
NBP1-88921 in the following applications:

Publications
Read Publications using
NBP1-88921 in the following applications:

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LPCAT2 Antibody

  • 1-alkylglycerophosphocholine O-acetyltransferase
  • Acetyl-CoA:lyso-PAF acetyltransferase
  • Acetyl-CoA:lyso-platelet-activating factor acetyltransferase
  • acyl-CoA:lysophosphatidylcholine acyltransferase 2
  • acyltransferase like 1
  • Acyltransferase-like 1
  • AYTL1LysoPAFAT
  • DKFZp686H22112
  • EC 2.3.1
  • EC 2.3.1.-
  • EC 2.3.1.23
  • EC 2.3.1.67,1-acylglycerophosphocholine O-acyltransferase
  • FLJ20481
  • LPC acyltransferase 2
  • LPCAT1
  • LPCAT-2
  • Lyso-PAF acetyltransferase
  • LysoPC acyltransferase 2
  • lysophosphatidylcholine acyltransferase 2
  • lyso-platelet-activating factor (PAF) acetyltransferase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88923
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB5018
Species: Hu
Applications: WB, IP
NBP2-04299
Species: Hu
MAB2669
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-57898
Species: Hu
Applications: WB, IHC-P
NBP2-19809
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-46177
Species: Hu
Applications: IP (-), WB, IHC, IHC-P
NBP1-92440
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14101
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-27104
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NBP1-05950
Species: Hu, Mu
Applications: WB, ICC/IF
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
2984-SE
Species: Hu
NBP1-82236
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32452
Species: Hu, Mu, Rt
Applications: WB
H00009261-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, PLA
H00006901-M12
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-88921
Species: Hu, Rt, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for LPCAT2 Antibody (NBP1-88921)(2)

We have publications tested in 1 confirmed species: Rat.

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(1)
WB
(1)
All Applications
Filter By Species
Rat
(1)
All Species

Reviews for LPCAT2 Antibody (NBP1-88921) (2) 4.52

Average Rating: 4.5
(Based on 2 reviews)
We have 2 reviews tested in 2 species: Mouse, Rat.
We have 2 reviews tested in 2 application: IHC-Fr, ICC.

Reviews using NBP1-88921:
Filter by Applications
IHC-Fr
(1)
ICC
(1)
All Applications
Filter by Species
Mouse
(1)
Rat
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Frozen LPCAT2 NBP1-88921
Enlarge
reviewed by:
Anonymous
IHC-Fr Rat 02/20/2015
View

Summary

ApplicationImmunohistochemistry-Frozen
Sample TestedRat neuronal tissue
SpeciesRat
Immunocytochemistry LPCAT2 NBP1-88921
Enlarge
reviewed by:
Martin Helley
ICC Mouse 02/12/2013
View

Summary

ApplicationImmunocytochemistry
Sample TestedRAW264.7 cells
SpeciesMouse

Blocking

Blocking Details10% normal donkey serum for 1 hour in an incubation chamber at room temperature

Primary Anitbody

Dilution Ratio1 hour in an incubation chamber at room temperature

Secondary Antibody

Secondary Descriptiondonkey anti rabbit

Details

Detection NotesFluorSav reagent
Fixation DetailsCell wash 2x PBS, cold MeOH -20C 10min, 2x wash PBS. Coverslips in cold acetone for 1min at -20C and washed 3x2 mins in PBS
Wash Description3x 2min wash with PBS

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LPCAT2 Antibody (NBP1-88921). (Showing 1 - 1 of 1 FAQs).

  1. Do you have an estimated band size for the LPCAT2 antibody (NBP1-88921) for Western blotting?
    • According to Uniprot, human LPCAT2 has a predicted molecular weight of approximately 60kDa. Please see UniProt entry Q7L5N7.

Secondary Antibodies

 

Isotype Controls

Additional LPCAT2 Products

Bioinformatics Tool for LPCAT2 Antibody (NBP1-88921)

Discover related pathways, diseases and genes to LPCAT2 Antibody (NBP1-88921). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LPCAT2 Antibody (NBP1-88921)

Discover more about diseases related to LPCAT2 Antibody (NBP1-88921).
 

Pathways for LPCAT2 Antibody (NBP1-88921)

View related products by pathway.

PTMs for LPCAT2 Antibody (NBP1-88921)

Learn more about PTMs related to LPCAT2 Antibody (NBP1-88921).

Blogs on LPCAT2

There are no specific blogs for LPCAT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4.5
5
1
4
1
3
0
2
0
1
0

Anonymous
02/20/2015
Application: IHC-Fr
Species: Rat

Martin Helley
02/12/2013
Application: ICC
Species: Mouse

Bioinformatics

Gene Symbol LPCAT2