LPCAT2 Antibody

Western Blot: LPCAT2 Antibody [NBP1-88921] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunocytochemistry/Immunofluorescence: LPCAT2 Antibody [NBP1-88921] - Staining of human cell line A-431 shows localization to endoplasmic reticulum & lipid droplets.

Immunohistochemistry-Paraffin: LPCAT2 Antibody [NBP1-88921] - Staining in human thyroid gland and skeletal muscle tissues using anti-LPCAT2 antibody. Corresponding LPCAT2 RNA-seq data are presented for the same tissues.

Western Blot: LPCAT2 Antibody [NBP1-88921] - Analysis in human thyroid gland tissue.

Immunocytochemistry/Immunofluorescence: LPCAT2 Antibody [NBP1-88921] - Staining of murine cell line RAW264.7. Image provided by product review by verified customer.

Immunohistochemistry-Frozen: LPCAT2 Antibody [NBP1-88921] - Staining of LPCAT2 in rat neuronal tissue using anti-LPCAT2 antibody. Image from verified customer review.

Immunohistochemistry-Paraffin: LPCAT2 Antibody [NBP1-88921] - Staining of human skeletal muscle shows low expression as expected.

Immunohistochemistry-Paraffin: LPCAT2 Antibody [NBP1-88921] - Staining of human thyroid gland shows high expression.

• Reactivity: Hu, Rt, Mu
• Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

LPCAT2 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FALFDRNHDGSIDFREYVIGLAVLCNPSNTEEIIQVAFKLFDVDEDGYITEEEFSTILQASLGVPDLDVSGLFKEIAQGDSISYEEFKSFALKHPEYAKIFTTYLDLQTCHVFSLPKEVQTTPSTASNKVSPE
• Specificity: Specificity of human, rat LPCAT2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Predicted Species: Mouse (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LPCAT2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Frozen 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  LPCAT2 Protein (NBP1-88921PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for LPCAT2 Antibody

• 1-alkylglycerophosphocholine O-acetyltransferase
• Acetyl-CoA:lyso-PAF acetyltransferase
• Acetyl-CoA:lyso-platelet-activating factor acetyltransferase
• acyl-CoA:lysophosphatidylcholine acyltransferase 2
• acyltransferase like 1
• Acyltransferase-like 1
• AYTL1LysoPAFAT
• DKFZp686H22112
• EC 2.3.1
• EC 2.3.1.-
• EC 2.3.1.23
• EC 2.3.1.67,1-acylglycerophosphocholine O-acyltransferase
• FLJ20481
• LPC acyltransferase 2
• LPCAT1
• LPCAT-2
• Lyso-PAF acetyltransferase
• LysoPC acyltransferase 2
• lysophosphatidylcholine acyltransferase 2
• lyso-platelet-activating factor (PAF) acetyltransferase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LPCAT2 Antibody (NBP1-88921)(2)

Publications using NBP1-88921

• Helley MP, Abate W, Jackson SK et al. The expression of Toll-like receptor 4, 7 and co-receptors in neurochemical sub-populations of rat trigeminal ganglion sensory neurons. Neuroscience. 2015 Dec 3 [PMID: 26434622] (ICC/IF, WB, Rat)
• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013 Apr [PMID: 23435261]

Reviews for LPCAT2 Antibody (NBP1-88921) (2)

Average Rating: 4.5

(Based on 2 reviews)

We have 2 reviews tested in 2 species: Mouse, Rat.

reviewed by: Anonymous IHC-Fr Rat 02/20/2015

Summary

• Application: Immunohistochemistry-Frozen
• Sample Tested: Rat neuronal tissue
• Species: Rat

reviewed by: Martin Helley ICC Mouse 02/12/2013

Summary

• Application: Immunocytochemistry
• Sample Tested: RAW264.7 cells
• Species: Mouse

Blocking

• Blocking Details: 10% normal donkey serum for 1 hour in an incubation chamber at room temperature

Primary Anitbody

• Dilution Ratio: 1 hour in an incubation chamber at room temperature

Secondary Antibody

• Secondary Description: donkey anti rabbit

Details

• Detection Notes: FluorSav reagent
• Fixation Details: Cell wash 2x PBS, cold MeOH -20C 10min, 2x wash PBS. Coverslips in cold acetone for 1min at -20C and washed 3x2 mins in PBS
• Wash Description: 3x 2min wash with PBS

FAQs for LPCAT2 Antibody (NBP1-88921). (Showing 1 - 1 of 1 FAQs).

1. Do you have an estimated band size for the LPCAT2 antibody (NBP1-88921) for Western blotting?
   • According to Uniprot, human LPCAT2 has a predicted molecular weight of approximately 60kDa. Please see UniProt entry Q7L5N7.

Bioinformatics

• Gene Symbol: LPCAT2