MBOAT1 Antibody


Western Blot: MBOAT1 Antibody [NBP1-55258] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

MBOAT1 Antibody Summary

Synthetic peptides corresponding to MBOAT1(membrane bound O-acyltransferase domain containing 1) The peptide sequence was selected from the N terminal of MBOAT1. Peptide sequence AAEPQPSSLSYRTTGSTYLHPLSELLGIPLDQVNFVVCQLVALFAAFWFR.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against MBOAT1 and was validated on Western blot.
Theoretical MW
56 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MBOAT1 Antibody

  • dJ434O11.1
  • EC 2.3.1.-
  • EC 2.3.1.n6,1-acylglycerophosphoserine O-acyltransferase
  • LPEAT1
  • LPLAT 1
  • lysophosphatidylethanolamine acyltransferase 1
  • Lysophosphatidylserine acyltransferase
  • lysophospholipid acyltransferase 1
  • Lyso-PS acyltransferase
  • membrane bound O-acyltransferase domain containing 1
  • Membrane-bound O-acyltransferase domain-containing protein 1
  • MGC44669
  • OACT1
  • O-acyltransferase (membrane bound) domain containing 1
  • O-acyltransferase domain-containing protein 1


MBOAT1 shares structural similarity with a superfamily of membrane-bound O-acetyltransferases that transfer organic compounds, usually fatty acids (e.g., cholesterol, diacylglycerol, palmitoyl), onto hydroxyl groups of membrane-embedded targets.MBOAT1 shares structural similarity with a superfamily of membrane-bound O-acetyltransferases that transfer organic compounds, usually fatty acids (e.g., cholesterol, diacylglycerol, palmitoyl), onto hydroxyl groups of membrane-embedded targets (Dauwerse et al., 2007 [PubMed 17440500]).[supplied by OMIM]. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-304 AL158198.14 79926-80229 c 305-450 AL158198.14 20414-20559 c 451-528 AL158198.14 18975-19052 c 529-624 AL158198.14 12010-12105 c 625-680 AL355139.10 10796-10851 c 681-735 AL355139.10 8351-8405 c 736-919 AL355139.10 6169-6352 c 920-1112 AL355139.10 4060-4252 c 1113-1216 AL008627.1 1909-2012 1217-1281 AL008627.1 5097-5161 1282-1414 AL008627.1 7441-7573 1415-1566 AL008627.1 10700-10851 1567-3275 AL008627.1 18037-19745


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC-P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Other, Pm
Applications: WB, Simple Western
Species: Hu, Mu(-)
Applications: WB, ICC/IF, IHC-Fr
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-P

Publications for MBOAT1 Antibody (NBP1-55258) (0)

There are no publications for MBOAT1 Antibody (NBP1-55258).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MBOAT1 Antibody (NBP1-55258) (0)

There are no reviews for MBOAT1 Antibody (NBP1-55258). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MBOAT1 Antibody (NBP1-55258) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional MBOAT1 Products

MBOAT1 NBP1-55258

Bioinformatics Tool for MBOAT1 Antibody (NBP1-55258)

Discover related pathways, diseases and genes to MBOAT1 Antibody (NBP1-55258). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MBOAT1 Antibody (NBP1-55258)

Discover more about diseases related to MBOAT1 Antibody (NBP1-55258).

Pathways for MBOAT1 Antibody (NBP1-55258)

View related products by pathway.

PTMs for MBOAT1 Antibody (NBP1-55258)

Learn more about PTMs related to MBOAT1 Antibody (NBP1-55258).

Blogs on MBOAT1

There are no specific blogs for MBOAT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MBOAT1 Antibody and receive a gift card or discount.


Gene Symbol MBOAT1