AGPAT6 Antibody (4C12)

Images

 
Immunocytochemistry/ Immunofluorescence: AGPAT6 Antibody (4C12) [H00137964-M02] - Analysis of monoclonal antibody to AGPAT6 on HeLa cell . Antibody concentration 10 ug/ml.
ELISA: AGPAT6 Antibody (4C12) [H00137964-M02] - Detection limit for recombinant GST tagged AGPAT6 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
4C12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

AGPAT6 Antibody (4C12) Summary

Immunogen
AGPAT6 (NP_848934.1, 39 a.a. ~ 137 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SFGIRKLYMKSLLKIFAWATLRMERGAKEKNHQLYKPYTNGIIAKDPTSLEEEIKEIRRSGSSKALDNTPEFELSDIFYFCRKGMETIMDDEVTKRFSA
Specificity
AGPAT6 - 1-acylglycerol-3-phosphate O-acyltransferase 6 (lysophosphatidic acid acyltransferase, zeta) (4C12)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
AGPAT6
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Western Blot 1:500
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for AGPAT6 Antibody (4C12)

  • 1-acylglycerol-3-phosphate O-acyltransferase 6 (lysophosphatidic acidacyltransferase, zeta)
  • Acyl-CoA:glycerol-3-phosphate acyltransferase 4
  • DKFZp586M1819,1-acyl-sn-glycerol-3-phosphate acyltransferase zeta
  • EC 2.3.1.15
  • glycerol-3-phosphate acyltransferase 4,1-AGP acyltransferase 6
  • glycerol-3-phosphate acyltransferase 6,1-AGPAT 6
  • GPAT4,1-acylglycerol-3-phosphate O-acyltransferase 6
  • LPAAT-zetaLPAATZ
  • Lysophosphatidic acid acyltransferase zeta
  • testis spermatogenesis apoptosis-related protein 7
  • TSARG7

Background

Lysophosphatidic acid acyltransferases (EC 2.3.1.51) catalyze the conversion of lysophosphatidic acid (LPA) to phosphatidic acid (PA). LPA and PA are involved in signal transduction and lipid biosynthesis.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76907
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-02056
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, WB
NB110-41487
Species: Hu, Mu, Rt
Applications: IB, ICC/IF, WB
NB400-114
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
AF7550
Species: Hu
Applications: KO, WB
NB110-57150
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP3-15744
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
AF7197
Species: Hu, Mu
Applications: ICC, IHC, WB
NBP2-19860
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB600-582
Species: Ca, Ch, SyHa, Ha, Hu, Pm, Mu, Rt
Applications: IHC-Fr, KO, Simple Western, WB
AF6868
Species: Hu
Applications: IHC, KO, WB
NBP1-90276
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-37477
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB400-144
Species: Bv, Hu, Mu, Po, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
MAB1678
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP3-05516
Species: Hu
Applications: IHC, IHC-P

Publications for AGPAT6 Antibody (H00137964-M02) (0)

There are no publications for AGPAT6 Antibody (H00137964-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AGPAT6 Antibody (H00137964-M02) (0)

There are no reviews for AGPAT6 Antibody (H00137964-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for AGPAT6 Antibody (H00137964-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AGPAT6 Products

Bioinformatics Tool for AGPAT6 Antibody (H00137964-M02)

Discover related pathways, diseases and genes to AGPAT6 Antibody (H00137964-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AGPAT6 Antibody (H00137964-M02)

Discover more about diseases related to AGPAT6 Antibody (H00137964-M02).
 

Pathways for AGPAT6 Antibody (H00137964-M02)

View related products by pathway.

PTMs for AGPAT6 Antibody (H00137964-M02)

Learn more about PTMs related to AGPAT6 Antibody (H00137964-M02).
 

Research Areas for AGPAT6 Antibody (H00137964-M02)

Find related products by research area.

Blogs on AGPAT6

There are no specific blogs for AGPAT6, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AGPAT6 Antibody (4C12) and receive a gift card or discount.

Bioinformatics

Gene Symbol AGPAT6
Entrez
Uniprot