Aggrecan Antibody (6L4T2)

Immunohistochemistry: Aggrecan Antibody (6L4T2) [NBP3-33191] - Immunohistochemistry analysis of paraffin-embedded Mouse bone marrow using Aggrecan Rabbit mAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Western Blot: Aggrecan Antibody (6L4T2) [NBP3-33191] - Western blot analysis of lysates from Mouse lung, using Aggrecan Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.

Immunohistochemistry: Aggrecan Antibody (6L4T2) [NBP3-33191] - Immunohistochemistry analysis of paraffin-embedded Rat bone marrow using Aggrecan Rabbit mAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

• Reactivity: Mu, Rt
• Applications: WB, ELISA, IHC
• Clone: 6L4T2
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Aggrecan Antibody (6L4T2) Summary

• Description: Novus Biologicals Rabbit Aggrecan Antibody (6L4T2) (NBP3-33191) is a monoclonal antibody validated for use in IHC, WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 761-861 of human Aggrecan (P16112).
  
  Sequence:
  WPPTGAATEESTEGPSATEVPSASEEPSPSEVPFPSEEPSPSEEPFPSVRPFPSVELFPSEEPFPSKEPSPSEEPSASEEPYTPSPPVPSWTELPSSGEES
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: ACAN
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:1000 - 1:4000
• Theoretical MW: 261 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Aggrecan Antibody (6L4T2)

• ACAN
• AGC1
• AGC1SEDK
• aggrecan core protein
• Aggrecan
• Cartilage-specific proteoglycan core protein
• Chondroitin sulfate proteoglycan 1
• Chondroitin sulfate proteoglycan core protein 1
• CSPCP
• CSPG1
• CSPG1aggrecan 1
• CSPGCP
• large aggregating proteoglycan
• MSK16
• MSK16AGCAN
• SEDK

Background

This aggrecan degradation product usually remains within the tissue still complexed to hyaluronan and link protein. Its release from the cartilage usually signals that there has been extensive catabolism of aggrecan, which allows large complexes containing this metabolite to be released from the tissue.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ACAN