ADAMTS2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ADAMTS2 Antibody [NBP1-89246] - Staining of human cell line BJ shows localization to plasma membrane & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ADAMTS2 Antibody [NBP1-89246] - Staining of human skin shows weak to moderate cytoplasmic positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: ADAMTS2 Antibody [NBP1-89246] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ADAMTS2 Antibody [NBP1-89246] - Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: ADAMTS2 Antibody [NBP1-89246] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ADAMTS2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VAMEVRPSPSTPLEVPLNASSTNATEDHPETNAVDEPYKIHGLEDEVQPSNLIPRRPSPYEKTRNQRIQELIDEMRKKEMLG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADAMTS2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ADAMTS2 Protein (NBP1-89246PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ADAMTS2 Antibody

  • A disintegrin and metalloproteinase with thrombospondin motifs 2
  • a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 2
  • ADAM metallopeptidase with thrombospondin type 1 motif, 2
  • ADAM-TS 2
  • ADAMTS2
  • ADAMTS-2
  • ADAM-TS2EC 3.4.24.14
  • ADAMTS-3
  • EC 3.4.24
  • EDSDERMS
  • HPCPNI
  • NPIDKFZp686F12218
  • PC I-NP
  • PCINP
  • PCI-NP
  • PCINPhPCPNI
  • PCPNI
  • PNPI
  • Procollagen I N-proteinase
  • Procollagen I/II amino propeptide-processing enzyme
  • Procollagen N-endopeptidase

Background

ADAMTS2 encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The enzyme encoded by this gene excises the N-propeptide of type I, type II and type V procollagens. Mutations in this gene cause Ehlers-Danlos syndrome type VIIC, a recessively inherited connective-tissue disorder. Alternative splicing results in two transcript variants. The short transcript encodes a protein which has no significant procollagen N-peptidase activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ADAMTS2 Antibody (NBP1-89246) (0)

There are no publications for ADAMTS2 Antibody (NBP1-89246).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADAMTS2 Antibody (NBP1-89246) (0)

There are no reviews for ADAMTS2 Antibody (NBP1-89246). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ADAMTS2 Antibody (NBP1-89246) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ADAMTS2 Products

Research Areas for ADAMTS2 Antibody (NBP1-89246)

Find related products by research area.

Blogs on ADAMTS2

There are no specific blogs for ADAMTS2, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ADAMTS2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ADAMTS2