AF4 Antibody

Images

 
Western Blot: AF4 Antibody [NBP1-69027] - Mouse Kidney lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AF4 Antibody Summary

Immunogen
Synthetic peptides corresponding to Aff1 (AF4/FMR2 family, member 1) The peptide sequence was selected from the N terminal of Aff1. Peptide sequence MAAHSSLYNEDRNLLRIREKERRNQEAHQEKEAFPEKAPLFPEPYKTAKG.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
Aff1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Aff1 and was validated on Western blot.
Theoretical MW
132 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for AF4 Antibody

  • AF-4
  • AF4/FMR2 family member 1
  • AF4/FMR2 family, member 1
  • AF4myeloid/lymphoid or mixed-lineage leukemia (trithorax (Drosophila) homolog);translocated to, 2
  • ALL1-fused gene from chromosome 4 protein
  • FEL
  • MLLT2MGC134969
  • myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila);translocated to, 2
  • PBM1
  • pre-B-cell monocytic leukemia partner 1
  • Protein AF-4
  • Protein FEL
  • Proto-oncogene AF4

Background

The function of Aff1 remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-248
Species: Hu
Applications: WB, IP
NB100-1566
Species: Hu
Applications: WB, IP
AF5414
Species: Hu
Applications: WB, Simple Western
NBP1-87714
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81872
Species: Hu
Applications: IHC, IHC-P
NBP1-84840
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-49154
Species: Hu
Applications: IHC
NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00027125-D01P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP1-80695
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP2-13955
Species: Hu
Applications: IHC, IHC-P
AF7829
Species: Hu
Applications: WB, IHC, ICC
NBP1-90222
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB7650
Species: Mu
Applications: WB, IHC
H00005087-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-15771
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready
NBP1-69027
Species: Mu
Applications: WB

Publications for AF4 Antibody (NBP1-69027) (0)

There are no publications for AF4 Antibody (NBP1-69027).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AF4 Antibody (NBP1-69027) (0)

There are no reviews for AF4 Antibody (NBP1-69027). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AF4 Antibody (NBP1-69027) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AF4 Products

Bioinformatics Tool for AF4 Antibody (NBP1-69027)

Discover related pathways, diseases and genes to AF4 Antibody (NBP1-69027). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AF4 Antibody (NBP1-69027)

Discover more about diseases related to AF4 Antibody (NBP1-69027).
 

Pathways for AF4 Antibody (NBP1-69027)

View related products by pathway.

PTMs for AF4 Antibody (NBP1-69027)

Learn more about PTMs related to AF4 Antibody (NBP1-69027).

Blogs on AF4

There are no specific blogs for AF4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AF4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol Aff1