AE2 Antibody - BSA Free

Western Blot: AE2 Antibody [NBP1-59858]

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

AE2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to SLC4A2(solute carrier family 4, anion exchanger, member 2) Antibody(against the N terminal of SLC4A2 (NP_003031). Peptide sequence MSSAPRRPAKGADSFCTPEPESLGPGTPGFPEQEEDELHRTLGVERFEEI. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC4A2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 137 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Reactivity Notes

Use in Rat reported in scientific literature (PMID:34897412) .

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for AE2 Antibody - BSA Free

• AE 2
• AE2anion exchanger 2 type a
• anion exchanger 2 type b2
• Anion exchanger 2
• BND3LHKB3anion exchange protein 2
• EPB3L1anion exchanger 2 type b1
• FLJ59028
• MPB3L
• NBND3
• Non-erythroid band 3-like protein
• Solute carrier family 4 member 2
• solute carrier family 4, anion exchanger, member 2 (erythrocyte membraneprotein band 3-like 1)

Background

SLC4A2 is a plasma membrane anion exchange protein of wide distribution.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for AE2 Antibody (NBP1-59858)(2)

Publications using NBP1-59858

• Wilson AD, Richards MA, Curtis MK et al. Acidic environments trigger intracellular H+-sensing FAK proteins to re-balance sarcolemmal acid-base transporters and auto-regulate cardiomyocyte pH Cardiovascular research 2021-12-13 [PMID: 34897412] (WB, Rat)
• W Na, EJ Lee, MK Kang, YH Kim, DY Kim, H Oh, SI Kim, SY Oh, YH Kang Aesculetin Inhibits Osteoclastic Bone Resorption through Blocking Ruffled Border Formation and Lysosomal Trafficking Int J Mol Sci, 2020-11-13;21(22):. 2020-11-13 [PMID: 33203061]

Bioinformatics

• Gene Symbol: SLC4A2
• Entrez:
  • 6522(Human)
• Uniprot:
  • P04920(Human)