AE Binding Protein 1/ACLP Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: AE Binding Protein 1/ACLP Antibody [NBP2-55784] - Staining of human cell line U-2 OS shows localization to vesicles.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AE Binding Protein 1/ACLP Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PPVKPLLPPLPPDYGDGYVIPNYDDMDYYFGPPPPQKPDAERQTDEEKEELKKPKKEDSSPKEETDKWAVEKGKDH
Specificity
Specificity of human AE Binding Protein 1/ACLP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AEBP1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for AE Binding Protein 1/ACLP Antibody

  • ACLP
  • ACLPadipocyte enhancer binding protein 1
  • AE binding protein 1
  • AE-binding protein 1adipocyte enhancer-binding protein 1
  • AEBP1
  • Aortic carboxypeptidase-like protein
  • FLJ33612

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22106
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
AF1443
Species: Mu, Rt
Applications: WB, Simple Western, IHC, ICC
AF3587
Species: Hu
Applications: WB, IHC, IP, CyTOF-ready, ICC, ICFlow
NBP1-89064
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB1144
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBL1-09456
Species: Hu
NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow, KO
NB600-507
Species: Hu, Mu, Rt, Rb
Applications: WB, PEP-ELISA
NB400-105
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Eq, Ha, Md, Pm, Rb
Applications: WB, Simple Western, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, GS, PCR
NB400-132
Species: Hu, Mu, Rt, ChHa, Ha, Mk, Rb
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-P, In vitro, Flow-IC
NBP2-67344
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P

Publications for AE Binding Protein 1/ACLP Antibody (NBP2-55784) (0)

There are no publications for AE Binding Protein 1/ACLP Antibody (NBP2-55784).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AE Binding Protein 1/ACLP Antibody (NBP2-55784) (0)

There are no reviews for AE Binding Protein 1/ACLP Antibody (NBP2-55784). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for AE Binding Protein 1/ACLP Antibody (NBP2-55784) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional AE Binding Protein 1/ACLP Products

Bioinformatics Tool for AE Binding Protein 1/ACLP Antibody (NBP2-55784)

Discover related pathways, diseases and genes to AE Binding Protein 1/ACLP Antibody (NBP2-55784). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AE Binding Protein 1/ACLP Antibody (NBP2-55784)

Discover more about diseases related to AE Binding Protein 1/ACLP Antibody (NBP2-55784).
 

Pathways for AE Binding Protein 1/ACLP Antibody (NBP2-55784)

View related products by pathway.

PTMs for AE Binding Protein 1/ACLP Antibody (NBP2-55784)

Learn more about PTMs related to AE Binding Protein 1/ACLP Antibody (NBP2-55784).

Blogs on AE Binding Protein 1/ACLP

There are no specific blogs for AE Binding Protein 1/ACLP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AE Binding Protein 1/ACLP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AEBP1