Recombinant Human AdipoR2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human AdipoR2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-386 of Human ADIPOR2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MNEPTENRLGCSRTPEPDIRLRKGHQLDGTRRGDNDSHQGDLEPILEASVLSSHHKKSSEEHEYSDEAPQEDEGFMGMSPLLQAHHAMEKMEEFVCKVWEGRWRVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGCVFFLCLGIFYMFRPNISFVAPLQEKVVFGLFFLGAILCLSFSWLFHTVYCHSEGVSRLFSKLDYSGIALLIMGSFVPWLYYSFYCNPQPCFIYLIVICVLGIAAIIVSQWDMFATPQYRGVRAGVFLGLGLSGIIPTLHYVISEGFLKAATIGQIGWLMLMASLYITGAALYAARIPERFFPGKCDIWFHSHQLFHIFVVAGAFVHFHGVSNLQEFRFMIGGGCSEEDAL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
ADIPOR2
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human AdipoR2 Protein

  • ACDCR2
  • adiponectin receptor 2
  • adiponectin receptor protein 2
  • AdipoR2
  • FLJ21432
  • PAQR2
  • PAQR2MGC4640
  • Progestin and adipoQ receptor family member II

Background

The adiponectin receptors, ADIPOR1 (MIM 607945) and ADIPOR2, serve as receptors for globular and full-length adiponectin (MIM 605441) and mediate increased AMPK (see MIM 602739) and PPAR-alpha (PPARA; MIM 170998) ligand activities, as well as fatty acid oxidation and glucose uptake by adiponectin (Yamauchi et al., 2003 [PubMed 12802337]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-28640
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-22127
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
AF2850
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP1-87487
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF497
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
H00006241-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
MAB7330
Species: Hu
Applications: CyTOF-ready, ICFlow
NBP1-76775
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB7075
Species: Hu
Applications: WB
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00079602-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for AdipoR2 Recombinant Protein (H00079602-P01) (0)

There are no publications for AdipoR2 Recombinant Protein (H00079602-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AdipoR2 Recombinant Protein (H00079602-P01) (0)

There are no reviews for AdipoR2 Recombinant Protein (H00079602-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AdipoR2 Recombinant Protein (H00079602-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional AdipoR2 Products

Bioinformatics Tool for AdipoR2 Recombinant Protein (H00079602-P01)

Discover related pathways, diseases and genes to AdipoR2 Recombinant Protein (H00079602-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AdipoR2 Recombinant Protein (H00079602-P01)

Discover more about diseases related to AdipoR2 Recombinant Protein (H00079602-P01).
 

Pathways for AdipoR2 Recombinant Protein (H00079602-P01)

View related products by pathway.

PTMs for AdipoR2 Recombinant Protein (H00079602-P01)

Learn more about PTMs related to AdipoR2 Recombinant Protein (H00079602-P01).
 

Research Areas for AdipoR2 Recombinant Protein (H00079602-P01)

Find related products by research area.

Blogs on AdipoR2

There are no specific blogs for AdipoR2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

AdipoR2 Antibody
NBP1-28641

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human AdipoR2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ADIPOR2
Entrez