Adenylosuccinate Synthase Antibody

Images

 
Western Blot: Adenylosuccinate Synthase Antibody [NBP1-90360] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: Adenylosuccinate Synthase Antibody [NBP1-90360] - Staining of human cell line U-251 MG shows localization to plasma membrane and cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Adenylosuccinate Synthase Antibody [NBP1-90360] - Staining of human rectum shows moderate to strong cytoplasmic positivity in glandular cells.
Western Blot: Adenylosuccinate Synthase Antibody [NBP1-90360] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-19
Orthogonal Strategies: Immunohistochemistry-Paraffin: Adenylosuccinate Synthase Antibody [NBP1-90360] - Analysis in human testis and skeletal muscle tissues. Corresponding ADSS RNA-seq data are presented for the ...read more
Immunohistochemistry-Paraffin: Adenylosuccinate Synthase Antibody [NBP1-90360] - Staining of human skeletal muscle shows weak cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: Adenylosuccinate Synthase Antibody [NBP1-90360] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: Adenylosuccinate Synthase Antibody [NBP1-90360] - Staining of human prostate shows moderate cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Adenylosuccinate Synthase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KLDGEIIPHIPANQEVLNKVEVQYKTLPGWNTDISNARAFKELPVNAQNYVRFIEDELQIPVKWIGVGKSRESM
Specificity
Specificity of human, mouse, rat Adenylosuccinate Synthase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADSS2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
50 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
Adenylosuccinate Synthase Protein (NBP1-90360PEP)
Publications
Read Publication using NBP1-90360.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Adenylosuccinate Synthase Antibody

  • ADEH
  • adenylosuccinate synthase
  • adenylosuccinate synthetase (Ade(-)H-complementing)
  • adenylosuccinate synthetase isozyme 2
  • Adenylosuccinate synthetase, acidic isozyme
  • Adenylosuccinate synthetase, liver isozyme
  • AdSS 2
  • ADSS2
  • AMPSase 2
  • EC 6.3.4.4
  • IMP--aspartate ligase 2
  • L-type adenylosuccinate synthetase
  • MGC20404

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91705
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83107
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03107
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
H00005813-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
H00122622-M01
Species: Hu
Applications: WB, ELISA, S-ELISA
NBP2-02056
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
MAB4218
Species: Hu
Applications: WB, IHC
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-33527
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89519
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15291
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02043
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF6240
Species: Hu
Applications: WB, ELISA, IHC
NBP2-48480
Species: Hu
Applications: Flow, IHC, IHC-Fr, Flow-CS
NBP1-00153
Species: Hu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-90235
Species: Hu, Mu, Rt, ChHa
Applications: WB, Simple Western, IHC, IHC-P
NB100-104
Species: Hu, Mu, Rt, Ca, Ma
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NBP1-89192
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD

Publications for Adenylosuccinate Synthase Antibody (NBP1-90360)(1)

Reviews for Adenylosuccinate Synthase Antibody (NBP1-90360) (0)

There are no reviews for Adenylosuccinate Synthase Antibody (NBP1-90360). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Adenylosuccinate Synthase Antibody (NBP1-90360) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Adenylosuccinate Synthase Products

Bioinformatics Tool for Adenylosuccinate Synthase Antibody (NBP1-90360)

Discover related pathways, diseases and genes to Adenylosuccinate Synthase Antibody (NBP1-90360). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Adenylosuccinate Synthase Antibody (NBP1-90360)

Discover more about diseases related to Adenylosuccinate Synthase Antibody (NBP1-90360).
 

Pathways for Adenylosuccinate Synthase Antibody (NBP1-90360)

View related products by pathway.

PTMs for Adenylosuccinate Synthase Antibody (NBP1-90360)

Learn more about PTMs related to Adenylosuccinate Synthase Antibody (NBP1-90360).
 

Research Areas for Adenylosuccinate Synthase Antibody (NBP1-90360)

Find related products by research area.

Blogs on Adenylosuccinate Synthase

There are no specific blogs for Adenylosuccinate Synthase, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Adenylosuccinate Synthase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ADSS2
Entrez
Uniprot