Adenylosuccinate Synthase Antibody - BSA Free

Immunohistochemistry-Paraffin: Adenylosuccinate Synthase Antibody [NBP1-90360] - Analysis in human testis and skeletal muscle tissues. Corresponding ADSS RNA-seq data are presented for the same tissues.

Western Blot: Adenylosuccinate Synthase Antibody [NBP1-90360] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Immunocytochemistry/Immunofluorescence: Adenylosuccinate Synthase Antibody [NBP1-90360] - Staining of human cell line U-251 MG shows localization to plasma membrane and cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Adenylosuccinate Synthase Antibody [NBP1-90360] - Staining of human rectum shows moderate to strong cytoplasmic positivity in glandular cells.

Western Blot: Adenylosuccinate Synthase Antibody [NBP1-90360] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-19

Immunohistochemistry-Paraffin: Adenylosuccinate Synthase Antibody [NBP1-90360] - Staining of human skeletal muscle shows weak cytoplasmic positivity in myocytes.

Immunohistochemistry-Paraffin: Adenylosuccinate Synthase Antibody [NBP1-90360] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: Adenylosuccinate Synthase Antibody [NBP1-90360] - Staining of human prostate shows moderate cytoplasmic and membranous positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Adenylosuccinate Synthase Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KLDGEIIPHIPANQEVLNKVEVQYKTLPGWNTDISNARAFKELPVNAQNYVRFIEDELQIPVKWIGVGKSRESM
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ADSS2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20-1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Theoretical MW: 50 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  Adenylosuccinate Synthase Protein (NBP1-90360PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Adenylosuccinate Synthase Antibody - BSA Free

• ADEH
• adenylosuccinate synthase
• adenylosuccinate synthetase (Ade(-)H-complementing)
• adenylosuccinate synthetase isozyme 2
• Adenylosuccinate synthetase, acidic isozyme
• Adenylosuccinate synthetase, liver isozyme
• AdSS 2
• ADSS2
• AMPSase 2
• EC 6.3.4.4
• IMP--aspartate ligase 2
• L-type adenylosuccinate synthetase
• MGC20404

Background

Adenylosuccinate synthetase catalyzes the first committed step in the conversion of IMP to AMP [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Adenylosuccinate Synthase Antibody (NBP1-90360)(1)

Publication using NBP1-90360

• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]

Bioinformatics

• Gene Symbol: ADSS2
• Entrez:
  • 159(Human)
• Uniprot:
  • P30520(Human)