Adenylosuccinate Synthase Antibody (1P8D9)

Western Blot: Adenylosuccinate Synthase Antibody (1P8D9) [NBP3-33245] - Western blot analysis of various lysates using Adenylosuccinate Synthase Rabbit mAb at 1:500 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clone: 1P8D9
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Adenylosuccinate Synthase Antibody (1P8D9) Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human Adenylosuccinate Synthase (P30520).
  
  Sequence:
  MAFAETYPAASSLPNGDCGRPRARPGGNRVTVVLGAQWGDEGKGKVVDLLAQDADIVCRCQGGNNAGHTVVVDSVEYDFHLLPSGIINPNVTAFIGNGVVIHLPGLFEEAEKNVQKGKGLEGWEKRLIISDRAHIVFDFHQAADGIQEQQRQEQAGKNLGTTKKGIGPVYSSKAARSGLR
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: ADSS2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 50 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Adenylosuccinate Synthase Antibody (1P8D9)

• ADEH
• adenylosuccinate synthase
• adenylosuccinate synthetase (Ade(-)H-complementing)
• adenylosuccinate synthetase isozyme 2
• Adenylosuccinate synthetase, acidic isozyme
• Adenylosuccinate synthetase, liver isozyme
• AdSS 2
• ADSS2
• AMPSase 2
• EC 6.3.4.4
• IMP--aspartate ligase 2
• L-type adenylosuccinate synthetase
• MGC20404

Background

Adenylosuccinate synthetase catalyzes the first committed step in the conversion of IMP to AMP [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ADSS2