Adenylosuccinate Lyase Antibody

Images

 
Western Blot: Adenylosuccinate Lyase Antibody [H00000158-D01P] - Analysis of ADSL expression in K-562.
Western Blot: Adenylosuccinate Lyase Antibody [H00000158-D01P] - Analysis of ADSL expression in transfected 293T cell line by ADSL polyclonal antibody.Lane 1: ADSL transfected lysate(54.90 KDa).Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Adenylosuccinate Lyase Antibody Summary

Immunogen
ADSL (NP_000017.1, 1 a.a. - 484 a.a.) full-length human protein. MAAGGDHGSPDSYRSPLASRYASPEMCFVFSDRYKFRTWRQLWLWLAEAEQTLGLPITDEQIQEMKSNLENIDFKMAAEEEKRLRHDVMAHVHTFGHCCPKAAGIIHLGATSCYVGDNTDLIILRNALDLLLPKLARVISRLADFAKERASLPTLGFTHFQPAQLTTVGKRCCLWIQDLCMDLQNLKRVRDDLRFRGVKGTTGTQASFLQLFEGDDHKVEQLDKMVTEKAGFKRAFIITGQTYTRKVDIEVLSVLASLGASVHKICTDIRLLANLKEMEEPFEKQQIGSSAMPYKRNPMRSERCCSLARHLMTLVMDPLQTASVQWFERTLDDSANRRICLAEAFLTADTILNTLQNISEGLVVYPKVIERRIRQELPFMATENIIMAMVKAGGSRQDCHEKIRVLSQQAASVVKQEGGDNDLIERIQVDAYFSPIHSQLDHLLDPSSFTGRASQQVQRFLEEEVYPLLKPYESVMKVKAELCL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADSL
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Adenylosuccinate Lyase Antibody

  • adenylosuccinase
  • adenylosuccinate lyase
  • AMPS
  • ASase
  • ASL
  • EC 4.3.2
  • EC 4.3.2.2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP1-00153
Species: Hu, Rt, Bv
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-90360
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89192
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91705
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83107
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
MAB6240
Species: Hu
Applications: WB, IHC
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-87408
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-44192
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-42388
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31336
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15291
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89519
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00000158-D01P
Species: Hu
Applications: WB

Publications for Adenylosuccinate Lyase Antibody (H00000158-D01P) (0)

There are no publications for Adenylosuccinate Lyase Antibody (H00000158-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Adenylosuccinate Lyase Antibody (H00000158-D01P) (0)

There are no reviews for Adenylosuccinate Lyase Antibody (H00000158-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Adenylosuccinate Lyase Antibody (H00000158-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Adenylosuccinate Lyase Products

Bioinformatics Tool for Adenylosuccinate Lyase Antibody (H00000158-D01P)

Discover related pathways, diseases and genes to Adenylosuccinate Lyase Antibody (H00000158-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Adenylosuccinate Lyase Antibody (H00000158-D01P)

Discover more about diseases related to Adenylosuccinate Lyase Antibody (H00000158-D01P).
 

Pathways for Adenylosuccinate Lyase Antibody (H00000158-D01P)

View related products by pathway.

PTMs for Adenylosuccinate Lyase Antibody (H00000158-D01P)

Learn more about PTMs related to Adenylosuccinate Lyase Antibody (H00000158-D01P).
 

Research Areas for Adenylosuccinate Lyase Antibody (H00000158-D01P)

Find related products by research area.

Blogs on Adenylosuccinate Lyase

There are no specific blogs for Adenylosuccinate Lyase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Adenylosuccinate Lyase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ADSL
Uniprot