Adenosine A3 R Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit Adenosine A3 R Antibody - BSA Free (NBP2-88764) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of human Adenosine A3 R. Peptide sequence: DFTELIVTDDKGTLANDFWSGKDLSGNKTRSCKAPKVVRKADRSRTSILI The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ADORA3 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for Adenosine A3 R Antibody - BSA Free
Background
A3 Adenosine Receptor is a widely expressed receptor that mediates the multiple functions of adenosine. For example, this receptor is believed to mediate the protective effect of adenosine released during cardiac ischemia. In lungs, the receptor mediates inhibition of eosinophil chemotaxis and may be useful in the treatment of eosinophil-dependent diseases such as asthma and rhinitis. Adenosine A3 Receptor has been reported mostly in brain, lung, liver, heart, kidney, and testis. ESTs have been isolated from heart/melanocyte/uterus, kidney, pituitary, and placenta libraries.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, IHC, Neut, WB
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Ca, Gp, Hu, Mu, Po, Rb, Rt, Sh
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: WB
Publications for Adenosine A3 R Antibody (NBP2-88764) (0)
There are no publications for Adenosine A3 R Antibody (NBP2-88764).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Adenosine A3 R Antibody (NBP2-88764) (0)
There are no reviews for Adenosine A3 R Antibody (NBP2-88764).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Adenosine A3 R Antibody (NBP2-88764) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Adenosine A3 R Products
Research Areas for Adenosine A3 R Antibody (NBP2-88764)
Find related products by research area.
|
Blogs on Adenosine A3 R