ADAMTS4 Antibody


Immunocytochemistry/ Immunofluorescence: ADAMTS4 Antibody [NBP2-57839] - Staining of human cell line U-251 MG shows localization to nuclear speckles.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF

Order Details

ADAMTS4 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ATHILVRQQGNPGHRSIYLALKLPDGSYALNGEYTLMPSPTDVVLPGAVSLRYSGATAASETLSGHGPLAQPLTLQVLVAGNPQDTRLRYSFFVP
Specificity of human ADAMTS4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (92%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for ADAMTS4 Antibody

  • a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 4
  • ADAM metallopeptidase with thrombospondin type 1 motif, 4
  • ADAM-TS 4
  • ADAMTS-2
  • ADAM-TS4
  • ADAMTS-4
  • ADMP-1
  • ADMP-1EC
  • Aggrecanase 1
  • aggrecanase-1
  • EC 3.4.24
  • KIAA0688A disintegrin and metalloproteinase with thrombospondin motifs 4


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Rt
Applications: WB, IHC, IP, ICC

Publications for ADAMTS4 Antibody (NBP2-57839) (0)

There are no publications for ADAMTS4 Antibody (NBP2-57839).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADAMTS4 Antibody (NBP2-57839) (0)

There are no reviews for ADAMTS4 Antibody (NBP2-57839). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ADAMTS4 Antibody (NBP2-57839) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional ADAMTS4 Products

Bioinformatics Tool for ADAMTS4 Antibody (NBP2-57839)

Discover related pathways, diseases and genes to ADAMTS4 Antibody (NBP2-57839). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADAMTS4 Antibody (NBP2-57839)

Discover more about diseases related to ADAMTS4 Antibody (NBP2-57839).

Pathways for ADAMTS4 Antibody (NBP2-57839)

View related products by pathway.

PTMs for ADAMTS4 Antibody (NBP2-57839)

Learn more about PTMs related to ADAMTS4 Antibody (NBP2-57839).

Research Areas for ADAMTS4 Antibody (NBP2-57839)

Find related products by research area.

Blogs on ADAMTS4

There are no specific blogs for ADAMTS4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ADAMTS4 Antibody and receive a gift card or discount.


Gene Symbol ADAMTS4