ADAMTS4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ADAMTS4 Antibody [NBP2-56239] - Staining of human cell line U-251 MG shows localization to nuclear speckles.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ADAMTS4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VEGLTVQYLGQAPELLGGAEPGTYLTGTINGDPESVASLHWDGGALLGVLQYRGAELHLQPLEGGTPNSAGGPGAHILRRKSPASGQGPMCN
Specificity
Specificity of human ADAMTS4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADAMTS4
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ADAMTS4 Antibody

  • a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 4
  • ADAM metallopeptidase with thrombospondin type 1 motif, 4
  • ADAM-TS 4
  • ADAMTS2
  • ADAMTS-2
  • ADAMTS4
  • ADAM-TS4
  • ADAMTS-4
  • ADMP-1
  • ADMP-1EC 3.4.24.82
  • Aggrecanase 1
  • aggrecanase-1
  • EC 3.4.24
  • KIAA0688A disintegrin and metalloproteinase with thrombospondin motifs 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89246
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-74350
Species: Hu, Mu, Rt, Po, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF5867
Species: Hu, Mu
Applications: WB, IHC, IP
NBP1-85432
Species: Hu
Applications: IHC, IHC-P
AF4009
Species: Hu, Rt
Applications: WB, IHC, IP, ICC

Publications for ADAMTS4 Antibody (NBP2-56239) (0)

There are no publications for ADAMTS4 Antibody (NBP2-56239).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADAMTS4 Antibody (NBP2-56239) (0)

There are no reviews for ADAMTS4 Antibody (NBP2-56239). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ADAMTS4 Antibody (NBP2-56239) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ADAMTS4 Products

Bioinformatics Tool for ADAMTS4 Antibody (NBP2-56239)

Discover related pathways, diseases and genes to ADAMTS4 Antibody (NBP2-56239). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADAMTS4 Antibody (NBP2-56239)

Discover more about diseases related to ADAMTS4 Antibody (NBP2-56239).
 

Pathways for ADAMTS4 Antibody (NBP2-56239)

View related products by pathway.

PTMs for ADAMTS4 Antibody (NBP2-56239)

Learn more about PTMs related to ADAMTS4 Antibody (NBP2-56239).
 

Research Areas for ADAMTS4 Antibody (NBP2-56239)

Find related products by research area.

Blogs on ADAMTS4

There are no specific blogs for ADAMTS4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ADAMTS4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ADAMTS4