ADAMTS4 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VEGLTVQYLGQAPELLGGAEPGTYLTGTINGDPESVASLHWDGGALLGVLQYRGAELHLQPLEGGTPNSAGGPGAHILRRKSPASGQGPMCN |
| Predicted Species |
Mouse (95%), Rat (92%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ADAMTS4 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for ADAMTS4 Antibody - BSA Free
Background
ADAMTS4, also known as aggrecanase-1, is a Metallopeptidase M12B type protease that is responsible for degradation of the articular cartilage protein aggrecan and the brain extracellular matrix proteoglycan brevican. The ADAMTS4 protein contains a signal sequence, a propeptide domain, a catalytic domain, a disintegrin-like motif, and a C-terminal domain with a thrombospondin (TSP) type 1 motif. ADAMTS4 has been implicated in inflammatory joint diseases, and it also may be a factor in the progression of glioma and Alzheimer's disease. ADAMTS4 expression has been documented in normal human brain, cartilage, heart, lung, placenta, muscle, and synovium. ESTs have been isolated from human tissue libraries, including normal brain, lung, pancreas, and skeletal muscle and cancerous breast.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Bv, Ca, Hu, Mu, Po, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: IHC, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: InhibAct
Species: Mu
Applications: ELISA
Species: Hu, Mu
Applications: IHC, IHC-P, mIF
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC, IP, KO, Neut, WB
Species: Hu, Rt
Applications: ICC, IHC, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF
Publications for ADAMTS4 Antibody (NBP2-56239) (0)
There are no publications for ADAMTS4 Antibody (NBP2-56239).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ADAMTS4 Antibody (NBP2-56239) (0)
There are no reviews for ADAMTS4 Antibody (NBP2-56239).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ADAMTS4 Antibody (NBP2-56239) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ADAMTS4 Products
Research Areas for ADAMTS4 Antibody (NBP2-56239)
Find related products by research area.
|
Blogs on ADAMTS4