ADAMTS4 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ADAMTS4 Antibody [NBP2-56239] - Staining of human cell line U-251 MG shows localization to nuclear speckles.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ADAMTS4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ADAMTS4 Antibody - BSA Free (NBP2-56239) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VEGLTVQYLGQAPELLGGAEPGTYLTGTINGDPESVASLHWDGGALLGVLQYRGAELHLQPLEGGTPNSAGGPGAHILRRKSPASGQGPMCN
• Predicted Species: Mouse (95%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ADAMTS4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ADAMTS4 Recombinant Protein Antigen (NBP2-56239PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ADAMTS4 Antibody - BSA Free

• a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 4
• ADAM metallopeptidase with thrombospondin type 1 motif, 4
• ADAM-TS 4
• ADAMTS-2
• ADAMTS4
• ADAM-TS4
• ADAMTS-4
• ADMP-1
• ADMP-1EC 3.4.24.82
• Aggrecanase 1
• aggrecanase-1
• EC 3.4.24
• KIAA0688A disintegrin and metalloproteinase with thrombospondin motifs 4

Background

ADAMTS4, also known as aggrecanase-1, is a Metallopeptidase M12B type protease that is responsible for degradation of the articular cartilage protein aggrecan and the brain extracellular matrix proteoglycan brevican. The ADAMTS4 protein contains a signal sequence, a propeptide domain, a catalytic domain, a disintegrin-like motif, and a C-terminal domain with a thrombospondin (TSP) type 1 motif. ADAMTS4 has been implicated in inflammatory joint diseases, and it also may be a factor in the progression of glioma and Alzheimer's disease. ADAMTS4 expression has been documented in normal human brain, cartilage, heart, lung, placenta, muscle, and synovium. ESTs have been isolated from human tissue libraries, including normal brain, lung, pancreas, and skeletal muscle and cancerous breast.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ADAMTS4