ADAM11 Antibody (3D4)

Images

 
Western Blot: ADAM11 Antibody (3D4) [H00004185-M01] - ADAM11 monoclonal antibody (M01), clone 3D4. Analysis of ADAM11 expression in human colon.
Sandwich ELISA: ADAM11 Antibody (3D4) [H00004185-M01] - Detection limit for recombinant GST tagged ADAM11 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3D4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ADAM11 Antibody (3D4) Summary

Immunogen
ADAM11 (NP_002381, 230 a.a. - 333 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GHPTVHSETKYVELIVINDHQLFEQMRQSVVLTSNFAKSVVNLADVIYKEQLNTRIVLVAMETWADGDKIQVQDDLLETLARLMVYRREGLPEPSDATHLFSGR
Specificity
ADAM11 - ADAM metallopeptidase domain 11
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ADAM11
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ADAM11 Antibody (3D4)

  • a disintegrin and metalloproteinase domain 11
  • ADAM metallopeptidase domain 11
  • disintegrin and metalloproteinase domain-containing protein 11
  • MDCADAM 11
  • Metalloproteinase-like, disintegrin-like, and cysteine-rich protein

Background

This gene encodes a member of the ADAM (a disintegrin and metalloprotease) protein family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This gene represents a candidate tumor supressor gene for human breast cancer based on its location within a minimal region of chromosome 17q21 previously defined by tumor deletion mapping.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1567
Species: Hu
Applications: Flow, CyTOF-reported
NBP2-37856
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86564
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP1-88347
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56992
Species: Hu
Applications: IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for ADAM11 Antibody (H00004185-M01) (0)

There are no publications for ADAM11 Antibody (H00004185-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADAM11 Antibody (H00004185-M01) (0)

There are no reviews for ADAM11 Antibody (H00004185-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ADAM11 Antibody (H00004185-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ADAM11 Products

Bioinformatics Tool for ADAM11 Antibody (H00004185-M01)

Discover related pathways, diseases and genes to ADAM11 Antibody (H00004185-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADAM11 Antibody (H00004185-M01)

Discover more about diseases related to ADAM11 Antibody (H00004185-M01).
 

Pathways for ADAM11 Antibody (H00004185-M01)

View related products by pathway.

PTMs for ADAM11 Antibody (H00004185-M01)

Learn more about PTMs related to ADAM11 Antibody (H00004185-M01).
 

Research Areas for ADAM11 Antibody (H00004185-M01)

Find related products by research area.

Blogs on ADAM11

There are no specific blogs for ADAM11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ADAM11 Antibody (3D4) and receive a gift card or discount.

Bioinformatics

Gene Symbol ADAM11
Entrez
OMIM
Uniprot