ACTR6 Antibody

Images

 
Western Blot: ACTR6 Antibody [NBP1-89000] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: ACTR6 Antibody [NBP1-89000] - Staining of human cell line U-251 MG shows positivity in plasma membrane and cytoplasm.
Immunohistochemistry-Paraffin: ACTR6 Antibody [NBP1-89000] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.
Western Blot: ACTR6 Antibody [NBP1-89000] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ACTR6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FYRDMDIAKLKGEENTVMIDYVLPDFSTIKKGFCKPREEMVLSGKYKSGEQILRLANERFAVPEILFNPSDIGIQEMGIPEAIV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACTR6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ACTR6 Protein (NBP1-89000PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ACTR6 Antibody

  • actin-related protein 6
  • ARP6 actin-related protein 6 homolog (yeast)
  • ARP6
  • FLJ13433
  • hARP6
  • hARPX
  • HSPC281
  • MSTP136

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84063
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-54619
Species: Hu, Mu
Applications: WB, ChIP, DB, ELISA, IF
NBP2-14306
Species: Hu
Applications: WB, IHC, IHC-P
H00057180-B01P
Species: Hu
Applications: WB, ELISA
NB100-61628
Species: Hu, Mu
Applications: IP (-), WB, Simple Western, ICC/IF, IHC, IHC-P, PLA
NBP1-57516
Species: Hu
Applications: WB
NBP2-34951
Species: Hu
MAB4675
Species: Mu
Applications: WB, IHC, Neut
NBP1-88838
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00057016-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB110-40623
Species: Hu
Applications: WB, ChIP, IHC, IHC-P, IP, PLA
NBP2-27562
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-56346
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
H00010096-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF2275
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-24551
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P

Publications for ACTR6 Antibody (NBP1-89000) (0)

There are no publications for ACTR6 Antibody (NBP1-89000).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACTR6 Antibody (NBP1-89000) (0)

There are no reviews for ACTR6 Antibody (NBP1-89000). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ACTR6 Antibody (NBP1-89000) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ACTR6 Products

Bioinformatics Tool for ACTR6 Antibody (NBP1-89000)

Discover related pathways, diseases and genes to ACTR6 Antibody (NBP1-89000). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for ACTR6 Antibody (NBP1-89000)

View related products by pathway.

Blogs on ACTR6

There are no specific blogs for ACTR6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACTR6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACTR6
Entrez
Uniprot