![Western Blot: ACTR3B Antibody [NBP2-92520] - Analysis of extracts of various cell lines, using ACTR3B at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 30s.](http://images.novusbio.com/fullsize/ACTR3B-Antibody-Western-Blot-NBP2-92520-img0001.jpg "Western Blot: ACTR3B Antibody [NBP2-92520] - Analysis of extracts of various cell lines, using ACTR3B at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 30s.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit ACTR3B Antibody - BSA Free (NBP2-92520) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 189-418 of human ACTR3B (NP_065178.1). CIKHIPIAGRDITYFIQQLLREREVGIPPEQSLETAKAIKEKYCYICPDIVKEFAKYDVDPRKWIKQYTGINAINQKKFVIDVGYERFLGPEIFFHPEFANPDFMESISDVVDEVIQNCPIDVRRPLYKNVVLSGGSTMFRDFGRRLQRDLKRVVDARLRLSEELSGGRIKPKPVEVQVVTHHMQRYAVWFGGSMLASTPEFFQVCHTKKDYEEYGPSICRHNPVFGVMS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ACTR3B |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for ACTR3B Antibody (NBP2-92520)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ACTR3B |
![Knockdown Validated COUP-TF II/NR2F2 Antibody (H7147) [Unconjugated]](https://images.novusbio.com/images/pp-h7147-00_human-coup-tf-ii-nr2f2-mab-clone-h7147-41202412505335.jpg)
![Knockdown Validated COUP-TF II/NR2F2 Antibody (H7147) [Unconjugated]](https://images.novusbio.com/images/pp-h7147-00_human-coup-tf-ii-nr2f2-mab-clone-h7147-41202412505337.jpg)
![Western Blot CRISP-1 Antibody (840017) [Unconjugated]](https://images.novusbio.com/images2/CRISP1_MAB4675_Western_Blot_16494.jpg)
![Immunohistochemistry CRISP-1 Antibody (840017) [Unconjugated]](https://images.novusbio.com/images2/CRISP1_MAB4675_Immunohistochemistry_16666.jpg)
![Neutralization CRISP-1 Antibody (840017) [Unconjugated]](https://images.novusbio.com/images2/CRISP1_MAB4675_Block_Neutralize_16780.jpg)
![Immunohistochemistry Angiopoietin-like Protein 1/ANGPTL1 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af2204_human-angiopoietin-like-1-affinity-purified-polyclonal-ab-immunohistochemistry-27122022161939.jpg)
![Immunohistochemistry PITX2 Antibody [Unconjugated]](https://images.novusbio.com/images2/PITX2_AF7388_Immunohistochemistry_12162.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")