Recombinant Human APOBEC3F GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human APOBEC3F GST (N-Term) Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 101 of Human APOBEC3F full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MKPHFRNTVERMYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPRLDAKIFRGQVPRSFIRAPFQVLSSPFGQCAPPHGTAQVQWPPQLTAGREQGRP

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
APOBEC3F
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
38.2 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human APOBEC3F GST (N-Term) Protein

  • apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3F
  • Apolipoprotein B mRNA-editing enzyme catalytic polypeptide-like 3F
  • ARP8
  • BK150C2.4.MRNA
  • DNA dC->dU-editing enzyme APOBEC-3F
  • EC 3.5.4
  • EC 3.5.4.-
  • induced upon T-cell activation
  • KA6
  • MGC74891

Background

This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88592
Species: Hu
Applications: IHC, IHC-P
NBP2-82073
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-39019
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-00131
Species: Hu
Applications: Flow, PEP-ELISA, WB
NBP1-78759
Species: Hu
Applications: IP, WB
NBP1-91682
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-22970
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP1-57440
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-21037
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-31361
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP1-88999
Species: Hu
Applications: IHC, IHC-P, WB
NB100-1226
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
AF3485
Species: Hu, Pm
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
NB100-61628
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP (-), Simple Western, WB
H00057180-B01P
Species: Hu
Applications: WB
202-IL
Species: Hu
Applications: BA

Publications for APOBEC3F Recombinant Protein (H00200316-P01) (0)

There are no publications for APOBEC3F Recombinant Protein (H00200316-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for APOBEC3F Recombinant Protein (H00200316-P01) (0)

There are no reviews for APOBEC3F Recombinant Protein (H00200316-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for APOBEC3F Recombinant Protein (H00200316-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional APOBEC3F Products

Bioinformatics Tool for APOBEC3F Recombinant Protein (H00200316-P01)

Discover related pathways, diseases and genes to APOBEC3F Recombinant Protein (H00200316-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for APOBEC3F Recombinant Protein (H00200316-P01)

Discover more about diseases related to APOBEC3F Recombinant Protein (H00200316-P01).
 

Pathways for APOBEC3F Recombinant Protein (H00200316-P01)

View related products by pathway.

PTMs for APOBEC3F Recombinant Protein (H00200316-P01)

Learn more about PTMs related to APOBEC3F Recombinant Protein (H00200316-P01).

Blogs on APOBEC3F

There are no specific blogs for APOBEC3F, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human APOBEC3F GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol APOBEC3F