![Western Blot: ACTR3B Antibody [NBP1-56602] - 721_B cell lysate, concentration 0.2-1 ug/ml.](http://images.novusbio.com/fullsize2/ACTR3B-Antibody-Western-Blot-NBP1-56602-img0002.jpg "Western Blot: ACTR3B Antibody [NBP1-56602] - 721_B cell lysate, concentration 0.2-1 ug/ml.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | Synthetic peptides corresponding to ACTR3B(ARP3 actin-related protein 3 homolog B (yeast)) Antibody(against the N terminal of ACTR3B.
Peptide sequence MAGSLPPCVVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRR. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ACTR3B |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
-Immunohistochemistry-Paraffin-NBP3-16424-img0001.jpg)
-Immunohistochemistry-Paraffin-NBP3-16424-img0002.jpg)
-Immunohistochemistry-Paraffin-NBP3-16424-img0003.jpg)
-Western-Blot-H00000473-M06-img0003.jpg)
-ELISA-H00000473-M06-img0002.jpg)
-Immunocytochemistry-Immunofluorescence-H00000473-M06-img0001.jpg)
-ELISA-NBP2-37399-img0001.jpg)
-Western-Blot-NBP2-37399-img0002.jpg)
-Western-Blot-NBP2-37399-img0003.jpg)
-Immunocytochemistry-Immunofluorescence-H00008878-M01-img0010.jpg)
-Western-Blot-H00008878-M01-img0015.jpg)
-Western-Blot-H00008878-M01-img0014.jpg)
Secondary Antibodies |
Isotype Controls |
Diseases for ACTR3B Antibody (NBP1-56602)Discover more about diseases related to ACTR3B Antibody (NBP1-56602).
|
Research Areas for ACTR3B Antibody (NBP1-56602)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot CRISP-1 Antibody (840017) [Unconjugated]](https://images.novusbio.com/images2/CRISP1_MAB4675_Western_Blot_16494.jpg)
![Immunohistochemistry CRISP-1 Antibody (840017) [Unconjugated]](https://images.novusbio.com/images2/CRISP1_MAB4675_Immunohistochemistry_16666.jpg)
![Neutralization CRISP-1 Antibody (840017) [Unconjugated]](https://images.novusbio.com/images2/CRISP1_MAB4675_Block_Neutralize_16780.jpg)
-ELISA-H00057016-M01-img0004.jpg)
-Immunocytochemistry-Immunofluorescence-H00057016-M01-img0007.jpg)
-Immunohistochemistry-Paraffin-H00057016-M01-img0009.jpg)
-Western-Blot-H00007873-M01-img0002.jpg)
-Immunocytochemistry-Immunofluorescence-H00007873-M01-img0006.jpg)
-Sandwich-ELISA-H00007873-M01-img0005.jpg)
![Immunohistochemistry Angiopoietin-like Protein 1/ANGPTL1 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af2204_human-angiopoietin-like-1-affinity-purified-polyclonal-ab-immunohistochemistry-27122022161939.jpg)
![Immunohistochemistry PITX2 Antibody [Unconjugated]](https://images.novusbio.com/images2/PITX2_AF7388_Immunohistochemistry_12162.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images2/Goat-anti-Rabbit-IgG-(H+L)-Secondary-Antibody-[HRP]-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")