ACTR3B Antibody

Images

 
Western Blot: ACTR3B Antibody [NBP1-56602] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ACTR3B Antibody Summary

Immunogen
Synthetic peptides corresponding to ACTR3B(ARP3 actin-related protein 3 homolog B (yeast)) Antibody(against the N terminal of ACTR3B. Peptide sequence MAGSLPPCVVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRR. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACTR3B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against ACTR3B and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ACTR3B Antibody

  • actin-related protein 3B
  • actin-related protein 3-beta
  • actin-related protein Arp11
  • Actin-related protein ARP4
  • ARP11Actin-like protein 3B
  • ARP3 actin-related protein 3 homolog B (yeast)
  • ARP3BETA
  • ARP3-beta
  • ARP4
  • DKFZp686O24114

Background

ACTR3B plays a role in the organization of the actin cytoskeleton.ACTR3B may function as ATP-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. ACTR3B may decrease the metastatic potential of tumors.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14306
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-75395
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
PP-H7147-00
Species: Hu
Applications: WB, IHC, IP
NBP2-15274
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-93451
Species: Hu
Applications: WB, PEP-ELISA
MAB4675
Species: Mu
Applications: WB, IHC, Neut
H00057016-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP1-90099
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2204
Species: Hu
Applications: WB, IHC
NBP1-88838
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00005308-M01
Species: Hu
Applications: WB, ChIP, ELISA, ICC/IF
NBP1-78758
Species: Hu
Applications: WB (-), IP
NB100-61628
Species: Hu, Mu
Applications: IP (-), WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-92770
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-49833
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-89000
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-37399
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-88999
Species: Hu
Applications: WB, IHC, IHC-P
H00008878-M01
Species: Hu, Mu, Rt, Bv, Ha, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-56602
Species: Hu
Applications: WB

Publications for ACTR3B Antibody (NBP1-56602) (0)

There are no publications for ACTR3B Antibody (NBP1-56602).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACTR3B Antibody (NBP1-56602) (0)

There are no reviews for ACTR3B Antibody (NBP1-56602). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ACTR3B Antibody (NBP1-56602) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ACTR3B Products

Bioinformatics Tool for ACTR3B Antibody (NBP1-56602)

Discover related pathways, diseases and genes to ACTR3B Antibody (NBP1-56602). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACTR3B Antibody (NBP1-56602)

Discover more about diseases related to ACTR3B Antibody (NBP1-56602).

Blogs on ACTR3B

There are no specific blogs for ACTR3B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACTR3B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACTR3B
Uniprot