Activin RIB/ALK-4 Recombinant Protein Antigen

Images

 
There are currently no images for Activin RIB/ALK-4 Protein (NBP2-39003PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Activin RIB/ALK-4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ACVR1B.

Source: E. coli

Amino Acid Sequence: GVQALLCACTSCLQANYTCETDGACMVSIFNLDGMEHHVRTCIPKVEL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ACVR1B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-39003.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Activin RIB/ALK-4 Recombinant Protein Antigen

  • activin A receptor, type IB
  • Activin receptor type IB
  • Activin receptor-like kinase 4
  • Activin RIB
  • ActivinRIB
  • ACTRIB
  • ACVR1B
  • ACVRLK4ACTR-IB
  • ALK4
  • ALK-4
  • ALK4activin A receptor, type II-like kinase 4
  • EC 2.7.11
  • EC 2.7.11.30
  • Serine/threonine-protein kinase receptor R2
  • SKR2activin receptor type-1B

Background

Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I (I and IB) and two type II (II and IIB) receptors. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with a cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling, and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. This gene encodes activin A type IB receptor, composed of 11 exons. Alternative splicing and alternative polyadenylation result in 3 fully described transcript variants. The mRNA expression of variants 1, 2, and 3 is confirmed, and a potential fourth variant contains an alternative exon 8 and lacks exons 9 through 11, but its mRNA expression has not been confirmed.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3797
Species: Hu, Mu
Applications: ChIP, ICC, IHC, Simple Western, WB
AF3025
Species: Hu
Applications: ELISA, ICC, WB
3218-ND
Species: Hu
Applications: BA
MAB77491
Species: Hu
Applications: CyTOF-ready, Flow
338-AC
Species: Hu, Mu, Rt
Applications: BA
NBP1-77836
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, Single-Cell Western, WB
AF339
Species: Hu
Applications: Block, IHC, WB
AF637
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
236-EG
Species: Hu
Applications: BA
AF340
Species: Hu
Applications: Block, IHC, WB
7754-BH/CF
Species: Hu
Applications: BA
DFN00
Species: Hu
Applications: ELISA
AF2097
Species: Hu
Applications: ChIP, ICC, WB
788-G8/CF
Species: Hu, Mu, Rt
Applications: BA
AF4210
Species: Hu
Applications: IHC, Simple Western, WB
355-BM
Species: Hu, Mu, Rt
Applications: BA
NBP2-39003PEP
Species: Hu
Applications: AC

Publications for Activin RIB/ALK-4 Protein (NBP2-39003PEP) (0)

There are no publications for Activin RIB/ALK-4 Protein (NBP2-39003PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Activin RIB/ALK-4 Protein (NBP2-39003PEP) (0)

There are no reviews for Activin RIB/ALK-4 Protein (NBP2-39003PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Activin RIB/ALK-4 Protein (NBP2-39003PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Activin RIB/ALK-4 Products

Research Areas for Activin RIB/ALK-4 Protein (NBP2-39003PEP)

Find related products by research area.

Blogs on Activin RIB/ALK-4

There are no specific blogs for Activin RIB/ALK-4, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Activin RIB/ALK-4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ACVR1B