actin, gamma 2 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human actin, gamma 2. Peptide sequence: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKPEYDEAGPSIVHRK The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ACTG2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for actin, gamma 2 Antibody - BSA Free
Background
All eukaryotic cells express actin, which often constitutes as much as 50% of total cellular protein. Actin filaments can form both stable and labile structures and are crucial components of microvilli and the contractile apparatus of muscle cells. While lower eukaryotes, such as yeast, have only one actin gene, higher eukaryotes have several isoforms encoded by a family of genes. At least six types of actin are present in mammalian tissues and fall into three classes. alpha actin expression is limited to various types of muscle, whereas beta and gamma are the principle constituents of filaments in other tissues. Members of the small GTPase family regulate the organization of the actin cytoskeleton. Rho controls the assembly of actin stress fibers and focal adhesion, Rac regulates actin filament accumulation at the plasma membrane and Cdc42 stimulates formation of filopodia.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IP, Neut, WB
Species: Mu
Applications: ELISA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
Species: Ca, Fe, Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: CyTOF-ready, IP, ICFlow, WB
Species: Mu
Applications: IP, WB
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: WB
Publications for actin, gamma 2 Antibody (NBP2-83925) (0)
There are no publications for actin, gamma 2 Antibody (NBP2-83925).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for actin, gamma 2 Antibody (NBP2-83925) (0)
There are no reviews for actin, gamma 2 Antibody (NBP2-83925).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for actin, gamma 2 Antibody (NBP2-83925) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional actin, gamma 2 Products
Blogs on actin, gamma 2