Actin Antibody (3U6B8)

Images

 
Western Blot: Actin Antibody (3U6B8) [NBP3-16100] - Western blot analysis of extracts of various cell lines, using Actin Rabbit mAb (NBP3-16100) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at ...read more
Immunohistochemistry: Actin Antibody (3U6B8) [NBP3-16100] - Immunohistochemistry analysis of paraffin-embedded Human kidney using alpha-Actin-1 Rabbit mAb at dilution of 1:100 (40x lens). Microwave antigen retrieval ...read more
Immunocytochemistry/ Immunofluorescence: Actin Antibody (3U6B8) [NBP3-16100] - Immunofluorescence analysis of paraffin-embedded rat skeletal muscle using alpha-Actin-1 Rabbit mAb at dilution of 1:100 (40x lens). ...read more
Immunocytochemistry/ Immunofluorescence: Actin Antibody (3U6B8) [NBP3-16100] - Immunofluorescence analysis of paraffin-embedded mouse skeletal muscle using alpha-Actin-1 Rabbit mAb at dilution of 1:100 (40x lens). ...read more
Immunohistochemistry: Actin Antibody (3U6B8) [NBP3-16100] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using alpha-Actin-1 Rabbit mAb at dilution of 1:100 (40x lens). Microwave antigen ...read more
Immunohistochemistry: Actin Antibody (3U6B8) [NBP3-16100] - Immunohistochemistry analysis of paraffin-embedded Human spleen using alpha-Actin-1 Rabbit mAb at dilution of 1:100 (40x lens). Microwave antigen retrieval ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clone
3U6B8
Clonality
Monoclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Actin Antibody (3U6B8) Summary

Additional Information
Recombinant Monoclonal Antibody
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 278-377 of human alpha-Actin-1 (ACTA1) (P68133). ETTYNSIMKCDIDIRKDLYANNVMSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWITKQEYDEAGPSIVHRKCF
Source
HEK293
Isotype
IgG
Clonality
Monoclonal
Host
Rabbit
Gene
ACTA1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Actin Antibody (3U6B8)

  • ACTA
  • Actin
  • actin, alpha 1, skeletal muscle
  • alpha skeletal muscle actin
  • alpha skeletal muscle
  • alpha-actin-1
  • ASMA
  • CFTD
  • CFTDM
  • MPFD
  • NEM1
  • NEM2
  • NEM3

Background

Actin is a 43kDa filament protien that is ubiquitously expressed by all eukaryotic cells. This wide expression makes Actin an ideal "housekeeping gene", which may even account for up to 50% of total cellular protein. Actin microfilaments can form both stable and labile structures and are crucial components of microvilli and the contractile apparatus of muscle cells. While lower eukaryotes, such as yeast, have only one Actin gene, higher eukaryotes have several isoforms encoded by a family of genes. At least six types of Actin are present in mammalian tissues and fall into three classes. alpha Actin expression is limited to various types of muscle, whereas beta and gamma are the principle constituents of filaments in other tissues. Members of the small GTPase family regulate the organization of the Actin cytoskeleton. Rho controls the assembly of Actin stress fibers and focal adhesion, Rac regulates Actin filament accumulation at the plasma membrane and Cdc42 stimulates formation of filopodia. Actin antibodies are most commonly used as controls for protein standardization or in cytoskeletan or cell cycle research.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81838
Species: Hu
Applications: IHC,  IHC-P, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
664-LI
Species: Hu
Applications: BA
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC,  IHC-P, Simple Western, WB
H00151056-B01P
Species: Hu, Mu
Applications: WB
AF3844
Species: Hu, Mu
Applications: IHC
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-15669
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
NB120-11099
Species: Al, Am, Av, Bv, Ch, Fi, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP1-32870
Species: Ch, Hu
Applications: IHC,  IHC-P, IP, KD, WB
H00007170-M02
Species: Hu
Applications: ELISA, IHC,  IHC-P, S-ELISA, WB
MAB5018
Species: Hu
Applications: IP, WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-24593
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP3-16100
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC

Publications for Actin Antibody (NBP3-16100) (0)

There are no publications for Actin Antibody (NBP3-16100).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Actin Antibody (NBP3-16100) (0)

There are no reviews for Actin Antibody (NBP3-16100). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Actin Antibody (NBP3-16100). (Showing 1 - 1 of 1 FAQ).

  1. I am interested in buying an Actin antibody to use in Western blot as a loading control. We would like to use it on rat heart samples. Can you make a recommendation?
    • I would recommend the Actin Antibody (mAbGEa) catalog # NB100-74340 . This antibody works great as a loading control in Western blot and has been validated for use with rat samples.

Secondary Antibodies

 

Isotype Controls

Additional Actin Products

Research Areas for Actin Antibody (NBP3-16100)

Find related products by research area.

Blogs on Actin. Showing 1-10 of 19 blog posts - Show all blog posts.

Migrasomes: A Novel Vesicle Involved in Intercellular Signaling
By Christina Towers, PhD What are migrasomes?A novel vesicular organelle was recently discovered in 2015 by a research group at Tsinghua University headed by Dr. Yu    that is dependent on cell migration...  Read full blog post.

Considerations for Quantitative Western blotting
By Jamshed Arslan, Pharm. D., PhD. Since its inception in 1979, Western blotting has undergone several developments. The use of radioactive probes was common throughout 1980s, but utilizing secondary antibodies labell...  Read full blog post.

Repurposing FDA-approved drugs to combat the rise of antibiotic resistance
By Beth Melson, MSAntibiotic resistance is a global threat to public health. Widespread, inappropriate use of antibiotics, such as to treat viral infections or promote growth in livestock, has led to increased incid...  Read full blog post.

The use of Beta Actin (AC-15) as a loading control across multiple species
Actin is a fundamental component of the cytoskeleton, where it has the ability to create and break down actin filament formation in response to various cell needs.  Actin has six highly conserved isoforms, however beta and gamma actin are the two...  Read full blog post.

The use of actin as a loading control in research on fruiting-body development and vegetative growth in Sordaria macrospora research
Sordaria macrospora is a filamentous fungus that serves as very useful system for scientific research due to a short life cycle and easy manipulation.  Just like any other model organism, it is important to have an effective loading control to va...  Read full blog post.

CRISPR/Cas9: Keep your friends close, but your viruses closer
"CRISPR", or clustered regularly interspaced short palindromic repeats, is an ancient bacterial mechanism that prevents the invasion of foreign pathogens to a host organism.  Specifically, the CRISPR sequence has been identified as a si...  Read full blog post.

Alpha-actin/ACTA1 - A skeletal muscle isoform mutated in various myopathies
Actin is an abundant cytoskeletal protein involved in a variety of cellular processes such as cell motility, cell division, and muscle contraction. Actin monomers assemble into filaments and can provide a track for transport of cargo by the molecul...  Read full blog post.

Alpha-Adducin - Assembling the cytoskeleton meshwork that underlies the plasma membrane
The structure and organization of the plasma membrane is maintained by an underlying network of cytoskeletal proteins including actin and spectrin. Adducin, a member of this protein network, binds to bundles and caps actin filaments and links them...  Read full blog post.

Understanding Actin Alpha 2 Smooth Muscle
Actins are extremely highly conserved structural proteins found in all eukaryotic cell cytoskeletons that govern cell structure, movement, and shape integrity. Six distinct actin isoforms, each encoded by a different gene and developmentally-regulated...  Read full blog post.

Could Laminin be Used to Treat Duchenne Muscular Dystrophy?
Duchenne muscular dystrophy (DMD) is a severe muscle wasting condition, causing disability and early death. There is currently no cure or adequate treatment for DMD, but pioneering research indicates that injection of a laminin protein may prevent (or...  Read full blog post.

Showing 1-10 of 19 blog posts - Show all blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Actin Antibody (3U6B8) and receive a gift card or discount.

Bioinformatics

Gene Symbol ACTA1