ACSL3 Recombinant Protein Antigen

Images

 
There are currently no images for ACSL3 Recombinant Protein Antigen (NBP2-58817PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ACSL3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ACSL3.

Source: E. coli

Amino Acid Sequence: KSNRIKAKPVNSKPDSAYRSVNSLDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ACSL3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58817.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ACSL3 Recombinant Protein Antigen

  • ACS3EC 6.2.1.3
  • acyl-CoA synthetase long-chain family member 3
  • FACL3lignoceroyl-CoA synthase
  • fatty-acid-Coenzyme A ligase, long-chain 3
  • LACS 3
  • LACS3
  • Long-chain acyl-CoA synthetase 3
  • long-chain-fatty-acid--CoA ligase 3
  • PRO2194

Background

Long-chain-fatty-acid--CoA ligase 3, or ACSL3, is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. These proteins play an important role in both the biosynthesis of cellular lipids and degradation via beta-oxidation. Like other isozymes of this family, ALCS3 converts free long-chain fatty acids into fatty acyl-CoA esters. Specifically, ACSL3 mediates hepatic lipogenesis By similarity and has a mainly anabolic role in energy metabolism.

This isozyme is highly expressed in brain, and preferentially utilizes myristate, arachidonate, and eicosapentaenoate as substrates. The amino acid sequence of this isozyme is 92% identical to that of rat homolog. Two transcript variants encoding the same protein have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-99585
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, Simple Western, WB
NBP2-16401
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-90276
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-90260
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00051703-M01
Species: Hu
Applications: ELISA, IHC,  IHC-P, IP, S-ELISA, WB
NBP1-92089
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-89269
Species: Hu
Applications: IHC,  IHC-P
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC,  IHC-P, WB
MAB3304
Species: Hu
Applications: CyTOF-ready, ICC, ICFlow
NB400-114
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KD, WB
NB400-105
Species: Ca, Ch, ChHa, Eq, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, ChIP, ChIP, Dual ISH-IHC, ELISA, Flow, GS, GS, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, PCR, Simple Western, WB
NB110-40877
Species: Bv, Hu, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP2-61616
Species: Hu
Applications: IHC,  IHC-P, KD, WB
8475-OM/CF
Species: Hu
Applications: BA
NBP2-20324
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-68160
Species: Hu, Mu
Applications: IHC,  IHC-P, PEP-ELISA, WB
NBP3-05516
Species: Hu
Applications: IHC,  IHC-P
NBP2-38530
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for ACSL3 Recombinant Protein Antigen (NBP2-58817PEP) (0)

There are no publications for ACSL3 Recombinant Protein Antigen (NBP2-58817PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACSL3 Recombinant Protein Antigen (NBP2-58817PEP) (0)

There are no reviews for ACSL3 Recombinant Protein Antigen (NBP2-58817PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ACSL3 Recombinant Protein Antigen (NBP2-58817PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ACSL3 Products

Research Areas for ACSL3 Recombinant Protein Antigen (NBP2-58817PEP)

Find related products by research area.

Blogs on ACSL3

There are no specific blogs for ACSL3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ACSL3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ACSL3