ACSL3 Recombinant Protein Antigen (NBP2-58817PEP)

Images

 
There are currently no images for ACSL3 Recombinant Protein Antigen (NBP2-58817PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ACSL3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ACSL3.

Source: E.coli

Amino Acid Sequence: KSNRIKAKPVNSKPDSAYRSVNSLDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGT

Protein/Peptide Type
Recombinant Protein Antigen
Gene
ACSL3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-58817 The protein was purified by IMAC chromatography and the expected concentration is greater than 0.5 mg/ml. This protein is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related protocol, click here.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ACSL3 Recombinant Protein Antigen

  • ACS3EC 6.2.1.3
  • acyl-CoA synthetase long-chain family member 3
  • FACL3lignoceroyl-CoA synthase
  • fatty-acid-Coenzyme A ligase, long-chain 3
  • LACS 3
  • LACS3
  • Long-chain acyl-CoA synthetase 3
  • long-chain-fatty-acid--CoA ligase 3
  • PRO2194

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-99585
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF
NBP2-16401
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-90276
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90260
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00051703-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP1-92088
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP1-89269
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
H00376497-D01P
Species: Hu, Mu
Applications: WB, ELISA
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB400-105
Species: Hu, Mu, Rt, Po, Ca, Ch, Ha, Md
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, GS
NB110-40877
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC-P
NBP1-91996
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-20324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92065
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37738
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-38530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ACSL3 Recombinant Protein Antigen (NBP2-58817PEP) (0)

There are no publications for ACSL3 Recombinant Protein Antigen (NBP2-58817PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACSL3 Recombinant Protein Antigen (NBP2-58817PEP) (0)

There are no reviews for ACSL3 Recombinant Protein Antigen (NBP2-58817PEP). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

FAQs for ACSL3 Recombinant Protein Antigen (NBP2-58817PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ACSL3 Products

Related Products by Gene

Bioinformatics Tool for ACSL3 Recombinant Protein Antigen (NBP2-58817PEP)

Discover related pathways, diseases and genes to ACSL3 Recombinant Protein Antigen (NBP2-58817PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACSL3 Recombinant Protein Antigen (NBP2-58817PEP)

Discover more about diseases related to ACSL3 Recombinant Protein Antigen (NBP2-58817PEP).
 

Pathways for ACSL3 Recombinant Protein Antigen (NBP2-58817PEP)

View related products by pathway.

PTMs for ACSL3 Recombinant Protein Antigen (NBP2-58817PEP)

Learn more about PTMs related to ACSL3 Recombinant Protein Antigen (NBP2-58817PEP).
 

Research Areas for ACSL3 Recombinant Protein Antigen (NBP2-58817PEP)

Find related products by research area.

Blogs on ACSL3

There are no specific blogs for ACSL3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ABCA1 Antibody
NB400-105
ABCA1 Antibody
NB400-105
ABCA1 Antibody
NB400-105
ACSL3 Antibody
H00002181-B01P
ACSL3 Antibody
H00002181-B01P

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ACSL3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ACSL3