Recombinant Human ACSL3 Protein (H00002181-Q01)

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ACSL3 Protein Summary

Description
ACSL3 (Human) GST-Tagged Recombinant Protein (Q01)

Source: Wheat Germ (in vitro)

Amino Acid Sequence: NETEVTNIITSKELLQTKLKDIVSLVPRLRHIITVDGKPPTWSEFPKGIIVHTMAAVEALGAKASMENQPHSKPLPSDIAVIMYTS
Protein/Peptide Type
Partial Recombinant Protein
Gene
ACSL3

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ACSL3 Protein

  • ACS3EC 6.2.1.3
  • acyl-CoA synthetase long-chain family member 3
  • FACL3lignoceroyl-CoA synthase
  • fatty-acid-Coenzyme A ligase, long-chain 3
  • LACS 3
  • LACS3
  • Long-chain acyl-CoA synthetase 3
  • long-chain-fatty-acid--CoA ligase 3
  • PRO2194

Background

ACSL3 - acyl-CoA synthetase long-chain family member 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-99585
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF
NBP2-16401
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-90276
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90260
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00051703-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP1-92088
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP1-89269
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
MAB3304
Species: Hu
Applications: CyTOF-ready, ICC, ICFlow
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB400-105
Species: Hu, Mu, Rt, Po, Ca, Ch, Ha, Md
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, GS
NB110-40877
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC-P
NBP1-91996
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-20324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92065
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37738
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-38530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ACSL3 Partial Recombinant Protein (H00002181-Q01) (0)

There are no publications for ACSL3 Partial Recombinant Protein (H00002181-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACSL3 Partial Recombinant Protein (H00002181-Q01) (0)

There are no reviews for ACSL3 Partial Recombinant Protein (H00002181-Q01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ACSL3 Partial Recombinant Protein (H00002181-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Recombinant Human ACSL3 Protein Products

Related Products by Gene

Bioinformatics Tool for ACSL3 Partial Recombinant Protein (H00002181-Q01)

Discover related pathways, diseases and genes to ACSL3 Partial Recombinant Protein (H00002181-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACSL3 Partial Recombinant Protein (H00002181-Q01)

Discover more about diseases related to ACSL3 Partial Recombinant Protein (H00002181-Q01).
 

Pathways for ACSL3 Partial Recombinant Protein (H00002181-Q01)

View related products by pathway.

PTMs for ACSL3 Partial Recombinant Protein (H00002181-Q01)

Learn more about PTMs related to ACSL3 Partial Recombinant Protein (H00002181-Q01).
 

Research Areas for ACSL3 Partial Recombinant Protein (H00002181-Q01)

Find related products by research area.

Blogs on ACSL3

There are no specific blogs for ACSL3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ACSL3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ACSL3

Customers Who Bought This Also Bought

ABCA1 Antibody
NB400-105
ABCA1 Antibody
NB400-105
ABCA1 Antibody
NB400-105
ACSL3 Antibody
H00002181-B01P
ACSL3 Antibody
H00002181-B01P