We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

ACSL1 Antibody - Azide and BSA Free

Images

 
Western Blot: ACSL1 Antibody [NBP2-92757] - Western blot analysis of extracts of various cell lines, using ACSL1 antibody (NBP2-92757) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 ...read more
Immunoprecipitation: ACSL1 Antibody [NBP2-92757] - Immunoprecipitation analysis of 300ug extracts of Raji cells using 3ug ACSL1 antibody (NBP2-92757). Western blot was performed from the immunoprecipitate using ACSL1 ...read more
Immunocytochemistry/ Immunofluorescence: ACSL1 Antibody - Azide and BSA Free [NBP2-92757] - Immunofluorescence analysis of paraffin-embedded mouse kidney using ACSL1 Rabbit pAb at dilution of 1:200 (40x lens). ...read more
Immunocytochemistry/ Immunofluorescence: ACSL1 Antibody - Azide and BSA Free [NBP2-92757] - Immunofluorescence analysis of HepG2 cells using ACSL1 Rabbit pAb at dilution of 1:200 (40x lens). Secondary antibody: ...read more
Immunocytochemistry/ Immunofluorescence: ACSL1 Antibody - Azide and BSA Free [NBP2-92757] - Immunofluorescence analysis of HeLa cells using ACSL1 Rabbit pAb at dilution of 1:200 (40x lens). Secondary antibody: ...read more
Immunocytochemistry/ Immunofluorescence: ACSL1 Antibody - Azide and BSA Free [NBP2-92757] - Immunofluorescence analysis of paraffin-embedded rat kidney using ACSL1 Rabbit pAb at dilution of 1:200 (40x lens). Secondary ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
Azide and BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

ACSL1 Antibody - Azide and BSA Free Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 46-145 of human ACSL1 (NP_001986.2). TRPKPLKPPCDLSMQSVEVAGSGGARRSALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEWLSYKQVAELSECIGSALIQKGFKTA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACSL1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunoprecipitation 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
  • Western Blot 1:500 - 1:1000
Theoretical MW
78 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ACSL1 Antibody - Azide and BSA Free

  • ACS1LACS 2
  • Acyl-CoA synthetase 1
  • acyl-CoA synthetase long-chain family member 1
  • EC 6.2.1
  • FACL1EC 6.2.1.3
  • fatty-acid-Coenzyme A ligase, long-chain 1
  • LACS 1
  • LACSlong-chain 2
  • lignoceroyl-CoA synthase
  • Long-chain acyl-CoA synthetase 1
  • Long-chain acyl-CoA synthetase 2
  • Long-chain fatty acid-CoA ligase 2
  • long-chain fatty-acid-coenzyme A ligase 1
  • long-chain-fatty-acid--CoA ligase 1
  • Palmitoyl-CoA ligase 1
  • Palmitoyl-CoA ligase 2
  • paltimoyl-CoA ligase 1

Background

Long-chain-fatty-acid--CoA ligase 1, or ACSL1, is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. These proteins play an important role in lipid biosynthesis and fatty acid degradation. Like other isozymes of this family, ALCS1 converts free long-chain fatty acids into fatty acyl-CoA esters. ACSL1 preferentially uses palmitoleate, oleate and linoleate, and altered expression of ACSL1 is thought to increase accumulation of triglycerides in the liver.

ALCS1 is strongly expressed in the heart, kindey, liver, skeletal muscle, and erythroid cells, and to a lesser extent in lung, brain, placenta and pancreas. This protein is predominantly expressed during the early stages of erythroid development, and expression is weak in reticulocytes and young erythrocytes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00051703-M01
Species: Hu
Applications: ELISA, IHC,  IHC-P, IP, S-ELISA, WB
NBP1-90276
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-15253
Species: Mu, Rt
Applications: WB
NBP1-92089
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-90260
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-16401
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
MAB3304
Species: Hu
Applications: CyTOF-ready, ICC, ICFlow
NBP2-15252
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NB300-537
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NB400-114
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KD, WB
NB110-40877
Species: Bv, Hu, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
MAB6898
Species: Hu, Mu
Applications: WB
NBP2-81909
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
NBP3-05516
Species: Hu
Applications: IHC,  IHC-P
NB400-144
Species: Av, Bv, Hu, Mu, Po, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF7197
Species: Hu, Mu
Applications: ICC, IHC, WB
NB110-37253
Species: Hu, Mu, Rt
Applications: WB
NBP2-92757
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IP
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Publications for ACSL1 Antibody (NBP2-92757) (0)

There are no publications for ACSL1 Antibody (NBP2-92757).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACSL1 Antibody (NBP2-92757) (0)

There are no reviews for ACSL1 Antibody (NBP2-92757). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ACSL1 Antibody (NBP2-92757) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ACSL1 Products

Array NBP2-92757

Research Areas for ACSL1 Antibody (NBP2-92757)

Find related products by research area.

Blogs on ACSL1.

Immune Cell Metabolic Flux Influences Type I Diabetes
By Hunter MartinezWhat is Immunometabolism?It is well established that abnormal metabolic environments can be a risk factor for disease development. One characteristic example is the role of dyslipidemia (high lev...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACSL1 Antibody - Azide and BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol ACSL1