ACOT1 Antibody - BSA Free

Western Blot: ACOT1 Antibody [NBP2-54709] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251 MG Lane 4: Human plasma Lane 5: Human Liver tissue

Immunocytochemistry/Immunofluorescence: ACOT1 Antibody [NBP2-54709] - Staining of human cell line U-2 OS shows localization to mitochondria.

Immunohistochemistry-Paraffin: ACOT1 Antibody [NBP2-54709] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ACOT1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a Recombinant Protein corresponding to amino acids: YKGETLPPVGVNRNRIKVTKDGYADIVDVLNSPLEGPDQKSFIPVERAESTFLFLVGQDDHNWK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ACOT1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ACOT1 Recombinant Protein Antigen (NBP2-54709PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ACOT1 Antibody - BSA Free

• ACH2
• acyl-CoA thioesterase 1Long chain acyl-CoA thioester hydrolase
• acyl-coenzyme A thioesterase 1
• CTE1
• CTE-1
• CTE-I
• CTE-Ib
• EC 3.1.2.2
• Inducible cytosolic acyl-coenzyme A thioester hydrolase
• LACH2
• Long chain acyl-CoA hydrolase

Background

Acyl-CoA thioesterases are a group of enzymes that catalyze the hydrolysis of acyl-CoAs to the free fattyacid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acidsand CoASH. Active towards fatty acyl-CoA with chain-lengths of C12-C16

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ACOT1