ACOT1 Antibody

Images

 
Western Blot: ACOT1 Antibody [NBP2-54709] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251 MG Lane 4: Human plasma Lane 5: Human Liver tissue
Immunocytochemistry/ Immunofluorescence: ACOT1 Antibody [NBP2-54709] - Staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: ACOT1 Antibody [NBP2-54709] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ACOT1 Antibody Summary

Immunogen
This antibody was developed against a Recombinant Protein corresponding to amino acids: YKGETLPPVGVNRNRIKVTKDGYADIVDVLNSPLEGPDQKSFIPVERAESTFLFLVGQDDHNWK
Specificity
Specificity of human ACOT1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACOT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ACOT1 Recombinant Protein Antigen (NBP2-54709PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ACOT1 Antibody

  • ACH2
  • acyl-CoA thioesterase 1Long chain acyl-CoA thioester hydrolase
  • acyl-coenzyme A thioesterase 1
  • CTE1
  • CTE-1
  • CTE-I
  • CTE-Ib
  • EC 3.1.2.2
  • Inducible cytosolic acyl-coenzyme A thioester hydrolase
  • LACH2
  • Long chain acyl-CoA hydrolase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP1-32452
Species: Hu, Mu, Rt
Applications: WB
NBP2-62632
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24608
Species: Hu, Mu, Rt, Pm
Applications: WB
NBP1-89679
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-22106
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP1-54578
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-Fr, IHC-P, IP, PLA, CyTOF-ready, KO
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NB600-582
Species: Hu, Mu, Rt, Ca, Ch, SyHa, Ha, Pm
Applications: WB, Simple Western, IHC-Fr, KO
NBP1-89278
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84730
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow, KO
NBP1-80950
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-07047
Species: Hu, Mu
Applications: WB, ICC/IF
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, KO

Publications for ACOT1 Antibody (NBP2-54709) (0)

There are no publications for ACOT1 Antibody (NBP2-54709).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACOT1 Antibody (NBP2-54709) (0)

There are no reviews for ACOT1 Antibody (NBP2-54709). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ACOT1 Antibody (NBP2-54709) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ACOT1 Products

Bioinformatics Tool for ACOT1 Antibody (NBP2-54709)

Discover related pathways, diseases and genes to ACOT1 Antibody (NBP2-54709). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACOT1 Antibody (NBP2-54709)

Discover more about diseases related to ACOT1 Antibody (NBP2-54709).
 

Pathways for ACOT1 Antibody (NBP2-54709)

View related products by pathway.

PTMs for ACOT1 Antibody (NBP2-54709)

Learn more about PTMs related to ACOT1 Antibody (NBP2-54709).

Blogs on ACOT1

There are no specific blogs for ACOT1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACOT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACOT1