Recombinant Human Aconitase 2 Protein

Images

 
SDS-Page: Recombinant Human Aconitase 2 Protein [H00000050-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Aconitase 2 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-179 of Human Aconitase 2

Source: Wheat Germ

Amino Acid Sequence: MAPYSLLVTRLQKALGVRQYHVASVLCQRAKVAMSHFEPNEYIHYDLLEKNINIVRKRLNRPLTLSEKIVYGHLDDPASQEIERGKSYLRLRPDRVAMQDATAQMAMLQFISSGLSKVAVPSTIHCDHLIEAQVGGEKDLRRAKDINQEVYNFLATAGAKYGVGFWKPGSGIIHQIILE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ACO2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
45.43 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Aconitase 2 Protein

  • aconitase 2, mitochondrial
  • Aconitase
  • aconitate hydratase, mitochondrial
  • ACONM
  • Citrate hydro-lyase
  • EC 4.2.1
  • EC 4.2.1.3
  • MGC20605
  • MGC33908

Background

ACO2 - aconitase 2, mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87677
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86135
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-25147
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, Simple Western, ICC/IF, IHC
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84318
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22166
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00000439-M03
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
AF6898
Species: Hu, Mu, Rt
Applications: WB
NBP2-16401
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP1-85871
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-1798
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, GS
NBP2-02705
Species: Hu, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NBP1-87311
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
MAB1936
Species: Hu
Applications: WB, IP
H00051703-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP1-31589
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF2540
Species: Hu
Applications: WB, IHC, IP

Publications for Aconitase 2 Partial Recombinant Protein (H00000050-Q01) (0)

There are no publications for Aconitase 2 Partial Recombinant Protein (H00000050-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Aconitase 2 Partial Recombinant Protein (H00000050-Q01) (0)

There are no reviews for Aconitase 2 Partial Recombinant Protein (H00000050-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Aconitase 2 Partial Recombinant Protein (H00000050-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Aconitase 2 Products

Bioinformatics Tool for Aconitase 2 Partial Recombinant Protein (H00000050-Q01)

Discover related pathways, diseases and genes to Aconitase 2 Partial Recombinant Protein (H00000050-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Aconitase 2 Partial Recombinant Protein (H00000050-Q01)

Discover more about diseases related to Aconitase 2 Partial Recombinant Protein (H00000050-Q01).
 

Pathways for Aconitase 2 Partial Recombinant Protein (H00000050-Q01)

View related products by pathway.

PTMs for Aconitase 2 Partial Recombinant Protein (H00000050-Q01)

Learn more about PTMs related to Aconitase 2 Partial Recombinant Protein (H00000050-Q01).
 

Research Areas for Aconitase 2 Partial Recombinant Protein (H00000050-Q01)

Find related products by research area.

Blogs on Aconitase 2

There are no specific blogs for Aconitase 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IRP2 Antibody
NB100-1798

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Aconitase 2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ACO2