ACMSD Antibody

Images

 
Western Blot: ACMSD Antibody [NBP1-86480] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: ACMSD Antibody [NBP1-86480] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ACMSD Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KGEAKLLKDGKVFRVVRENCWDPEVRIREMDQKGVTVQALSTVPVMFSYWAKPEDTLNLCQLLNNDLASTVVSYPRRFVGLGTLPMQAPELAVKEMERCVKELGFPGVQIGTHVNEWDLNAQELFPVYAAAERLKCSLFVHPW
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACMSD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ACMSD Protein (NBP1-86480PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ACMSD Antibody

  • aminocarboxymuconate semialdehyde decarboxylase
  • EC 4.1.1.45,2-amino-3-carboxymuconate-6-semialdehyde decarboxylase
  • Picolinate carboxylase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-45995
Species: Hu
Applications: WB, IHC
NBP2-02860
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB7389
Species: Mu
Applications: WB, IHC
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87243
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4736
Species: Hu
Applications: WB
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
DDX0191P-100
Species: Hu, Mu, Ca, Fe, Sh
Applications: ICC/IF, IHC, IHC-P
NBP1-81254
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-268
Species: Hu, Mu, Bv, Ce
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-87001
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-48021
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-32398
Species: Hu
Applications: IHC, IHC-P
NBP2-39015
Species: Hu
Applications: WB, IHC, IHC-P
NB300-206
Species: Hu, Mu, Rt, Ba
Applications: WB, IHC, IP
NBP1-85892
Species: Hu
Applications: WB, IHC, IHC-P

Publications for ACMSD Antibody (NBP1-86480) (0)

There are no publications for ACMSD Antibody (NBP1-86480).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACMSD Antibody (NBP1-86480) (0)

There are no reviews for ACMSD Antibody (NBP1-86480). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ACMSD Antibody (NBP1-86480) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ACMSD Products

Bioinformatics Tool for ACMSD Antibody (NBP1-86480)

Discover related pathways, diseases and genes to ACMSD Antibody (NBP1-86480). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACMSD Antibody (NBP1-86480)

Discover more about diseases related to ACMSD Antibody (NBP1-86480).
 

Pathways for ACMSD Antibody (NBP1-86480)

View related products by pathway.

PTMs for ACMSD Antibody (NBP1-86480)

Learn more about PTMs related to ACMSD Antibody (NBP1-86480).

Blogs on ACMSD

There are no specific blogs for ACMSD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACMSD Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACMSD