Recombinant Human Acetyl CoA synthetase Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Acetyl CoA synthetase Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 32-130 of Human ACSS2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:PPEVSRSAHVPSLQRYRELHRRSVEEPREFWGDIAKEFYWKTPCPGPFLRYNFDVTKGKIFIEWMKGATTNICYNVLDRNVHEKKLGDKVAFYWEGNEP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
ACSS2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Acetyl CoA synthetase Protein

  • ACAS2
  • AceCS
  • acetate thiokinase
  • acetate-CoA ligase
  • Acetate--CoA ligase
  • Acetyl-CoA synthetase
  • acetyl-Coenzyme A synthetase 2 (ADP forming)
  • acetyl-coenzyme A synthetase, cytoplasmic
  • ACSA
  • ACSACECS
  • Acyl-activating enzyme
  • acyl-CoA synthetase short-chain family member 2EC 6.2.1.1
  • cytoplasmic acetyl-coenzyme A synthetase
  • dJ1161H23.1
  • DKFZp762G026
  • EC 6.2.1

Background

This gene encodes a cytosolic enzyme that catalyzes the activation of acetate for use in lipid synthesis and energy generation. The protein acts as a monomer and produces acetyl-CoA from acetate in a reaction that requires ATP. Expression of this gene is regulated by sterol regulatory element-binding proteins, transcription factors that activate genes required for the synthesis of cholesterol and unsaturated fatty acids. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01833
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF5739
Species: Hu, Mu, Rt
Applications: WB
355-BM/CF
Species: Hu, Mu, Rt
NB100-56561
Species: Hu, Mu, Rt
Applications: WB
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
H00051703-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
AF6898
Species: Hu, Mu, Rt
Applications: WB
NB110-99585
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-89269
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
NBP2-15139
Species: Hu
Applications: WB, IHC, IHC-P
H00055902-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Acetyl CoA synthetase Partial Recombinant Protein (H00055902-Q01) (0)

There are no publications for Acetyl CoA synthetase Partial Recombinant Protein (H00055902-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Acetyl CoA synthetase Partial Recombinant Protein (H00055902-Q01) (0)

There are no reviews for Acetyl CoA synthetase Partial Recombinant Protein (H00055902-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Acetyl CoA synthetase Partial Recombinant Protein (H00055902-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Acetyl CoA synthetase Products

Bioinformatics Tool for Acetyl CoA synthetase Partial Recombinant Protein (H00055902-Q01)

Discover related pathways, diseases and genes to Acetyl CoA synthetase Partial Recombinant Protein (H00055902-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Acetyl CoA synthetase Partial Recombinant Protein (H00055902-Q01)

Discover more about diseases related to Acetyl CoA synthetase Partial Recombinant Protein (H00055902-Q01).
 

Pathways for Acetyl CoA synthetase Partial Recombinant Protein (H00055902-Q01)

View related products by pathway.

Blogs on Acetyl CoA synthetase

There are no specific blogs for Acetyl CoA synthetase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BMP-2 [Unconjugated]
355-BM-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Acetyl CoA synthetase Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ACSS2