ACD Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ACD Antibody [NBP2-33839] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear bodies.

Immunohistochemistry-Paraffin: ACD Antibody [NBP2-33839] - Staining of human adrenal gland shows strong nuclear positivity in glandular cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ACD Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ACD Antibody - BSA Free (NBP2-33839) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: IRELILGSETPSSPRAGQLLEVLQDAEAAVAGPSHAPDTSDVGATLLVSDGTHSVRCLVTREALDTSDWEEKEFGFRGTEGRLLLLQDCGVHVQVA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ACD
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ACD Protein (NBP2-33839PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ACD Antibody - BSA Free

• adrenocortical dysplasia homolog (mouse)
• Pip1
• PIP1Tint1
• POT1 and TIN2 organizing protein
• POT1 and TIN2-interacting protein
• Ptop
• PTOPTpp1
• TIN2 interacting protein 1
• TINT1adrenocortical dysplasia protein homolog
• TPP1

Background

ACD encodes a protein that is involved in telomere function. This protein is one of six core proteins in the telosome/shelterin telomeric complex, which functions to maintain telomere length and to protect telomere ends. Through its interaction with other components, this protein plays a key role in the assembly and stabilization of this complex, and it mediates the access of telomerase to the telomere. Multiple transcript variants encoding different isoforms have been found for this gene. This gene, which is also referred to as TPP1, is distinct from the unrelated TPP1 gene on chromosome 11, which encodes tripeptidyl-peptidase I.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ACD
• Uniprot:
  • Q96AP0(Human)