ACD Antibody

Images

 
Western Blot: ACD Antibody [NBP1-53154] - NCI-H226 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ACD Antibody Summary

Immunogen
Synthetic peptides corresponding to ACD(adrenocortical dysplasia homolog (mouse)) The peptide sequence was selected from the middle region of ACD (NP_001075955). Peptide sequence KNRPPFPRTGATRGAQEPCSVWEPPKRHRDGSAFQYEYEPPCTSLCARVQ.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against ACD and was validated on Western blot.
Theoretical MW
58 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ACD Antibody

  • adrenocortical dysplasia homolog (mouse)
  • Pip1
  • PIP1Tint1
  • POT1 and TIN2 organizing protein
  • POT1 and TIN2-interacting protein
  • Ptop
  • PTOPTpp1
  • TIN2 interacting protein 1
  • TINT1adrenocortical dysplasia protein homolog
  • TPP1

Background

ACD is a protein that is involved in telomere function. This protein is one of six core proteins in the telosome/shelterin telomeric complex, which functions to maintain telomere length and to protect telomere ends. Through its interaction with other comp

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56506
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, CyTOF-ready
NB500-176
Species: Hu
Applications: WB
NB600-1522
Species: Hu, Mu
Applications: WB, GS, ICC/IF
NBP1-85487
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47914
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB110-68281
Species: Hu, Mu, Rt, Mk
Applications: ICC/IF (-), WB, Simple Western, ELISA, Flow
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-292
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89296
Species: Hu
Applications: WB, IHC, IHC-P
NB100-317
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-22526
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-49938
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-45388
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-53154
Species: Hu
Applications: WB

Publications for ACD Antibody (NBP1-53154) (0)

There are no publications for ACD Antibody (NBP1-53154).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACD Antibody (NBP1-53154) (0)

There are no reviews for ACD Antibody (NBP1-53154). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ACD Antibody (NBP1-53154) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ACD Products

Bioinformatics Tool for ACD Antibody (NBP1-53154)

Discover related pathways, diseases and genes to ACD Antibody (NBP1-53154). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACD Antibody (NBP1-53154)

Discover more about diseases related to ACD Antibody (NBP1-53154).
 

Pathways for ACD Antibody (NBP1-53154)

View related products by pathway.

PTMs for ACD Antibody (NBP1-53154)

Learn more about PTMs related to ACD Antibody (NBP1-53154).

Blogs on ACD.

Application Highlight: Recent uses of TERF2 in immunofluorescence (IF)
Telomeres are a region of repeat nucleotide sequences located at the end of chromosomes to protect our DNA from becoming damaged via end-to-end fusion.  TERF2, or telomeric-repeat binding factor 2, is important for telomere integrity and aids in th...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACD Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACD
Entrez
Uniprot