ACBD3 Antibody - BSA Free

Western Blot: ACBD3 Antibody [NBP3-35682] - Western blot analysis of various lysates using ACBD3 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.

Immunocytochemistry/ Immunofluorescence: ACBD3 Antibody [NBP3-35682] - Immunofluorescence analysis of L929 cells using ACBD3 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: ACBD3 Antibody [NBP3-35682] - Immunofluorescence analysis of C6 cells using ACBD3 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ACBD3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ACBD3 Antibody - BSA Free (NBP3-35682) is a polyclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human ACBD3 (NP_073572.2).
  
  Sequence:
  MAAVLNAERLEVSVDGLTLSPDPEERPGAEGAPLLPPPLPPPSPPGSGRGPGASGEQPEPGEAAAGGAAEEARRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYEEKLKLVALHKQVLMGPYNPDTCPEVGFFDVLGNDRRREWAALGNMSKEDAMVE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ACBD3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 61 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for ACBD3 Antibody - BSA Free

• acyl-CoA binding domain containing 3
• Acyl-CoA-binding domain-containing protein 3
• acyl-Coenzyme A binding domain containing 3
• GCP60Golgi phosphoprotein 1
• GOCAP1Peripheral benzodiazepine receptor-associated protein PAP7
• golgi complex associated protein 1, 60kDa
• Golgi complex-associated protein 1
• Golgi resident protein GCP60
• GOLPH1PBR- and PKA-associated protein 7
• PAP7
• PBR associated protein
• peripherial benzodiazepine receptor associated protein
• PKA (RIalpha)-associated protein

Background

The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is involved in the maintenance of Golgi structure and function through its interaction with the integral membrane protein giantin. It may also be involved in the hormonal regulation of steroid formation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ACBD3