ACAT2 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit ACAT2 Antibody - BSA Free (NBP1-85967) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: IIGSFNGALAAVPVQDLGSTVIKEVLKRATVAPEDVSEVIFGHVLAAGCGQNPVRQASVGAGIPYSVPAW |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ACAT2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (84%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for ACAT2 Antibody - BSA Free
Background
The product of this gene is an enzyme involved in lipid metabolism, and it encodes cytosolic acetoacetyl-CoA thiolase. This gene shows complementary overlapping with the 3-prime region of the TCP1 gene in both mouse and human. These genes are encoded on opposite strands of DNA, as well as in opposite transcriptional orientation.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ha, Hu, Mu
Applications: ICC/IF, IP, WB
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC-P, IP, Simple Western, WB
Species: Dr, Hu, Mu
Applications: WB
Species: Mu
Applications: Block, CyTOF-ready, Flow, IHC, WB
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB
Species: Ca, Ch, ChHa, Eq, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, ChIP, ChIP, Dual ISH-IHC, ELISA, Flow, GS, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, PCR, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
Species: Hu, Mu, Rt
Applications: IP, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
Species: Hu
Applications: ICC
Publications for ACAT2 Antibody (NBP1-85967) (0)
There are no publications for ACAT2 Antibody (NBP1-85967).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ACAT2 Antibody (NBP1-85967) (0)
There are no reviews for ACAT2 Antibody (NBP1-85967).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ACAT2 Antibody (NBP1-85967) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ACAT2 Products
Research Areas for ACAT2 Antibody (NBP1-85967)
Find related products by research area.
|
Blogs on ACAT2