ACAD9 Antibody

Images

 
Western Blot: ACAD9 Antibody [NBP1-74272] - 721_B Cell Lysate 1ug/ml Gel Concentration 12%

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ACAD9 Antibody Summary

Immunogen
Synthetic peptides corresponding to the C terminal of ACAD9. Immunizing peptide sequence RSIRIGLRNHDHEVLLANTFCVEAYLQNLFSLSQLDKYAPENLDEQIKKV.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACAD9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ACAD9 and was validated on Western blot.
Theoretical MW
68 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ACAD9 Antibody

  • ACAD-9
  • acyl-CoA dehydrogenase family member 9, mitochondrial
  • acyl-CoA dehydrogenase family, member 9
  • acyl-Coenzyme A dehydrogenase family, member 9
  • EC 1.3.99
  • EC 1.3.99.-
  • EC 1.3.99.10
  • FLJ23533
  • MGC14452
  • NPD002

Background

This gene encodes a member of the acyl-CoA dehydrogenase family. Members of this family of proteins localize to the mitochondria and catalyze the rate-limiting step in the beta-oxidation of fatty acyl-CoA. The encoded protein is specifically active toward palmitoyl-CoA and long-chain unsaturated substrates. Mutations in this gene cause acyl-CoA dehydrogenase family member type 9 deficiency.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89290
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-54378
Species: Hu
Applications: WB, ICC/IF, IHC
H00000034-D01P
Species: Hu, Mu, Rt
Applications: WB
NB100-53791
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-49511
Species: Hu
Applications: WB, IHC
NBP1-83950
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14255
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91858
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4096
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-84503
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03047
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-06672
Species: Hu
NBP2-48549
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15659
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB2476
Species: Hu
Applications: WB, IHC
NBP1-85702
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56780
Species: Hu
Applications: WB, ICC/IF
NB100-182
Species: Hu, Mu, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, RNAi
NBP1-89289
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-74272
Species: Hu
Applications: WB

Publications for ACAD9 Antibody (NBP1-74272) (0)

There are no publications for ACAD9 Antibody (NBP1-74272).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACAD9 Antibody (NBP1-74272) (0)

There are no reviews for ACAD9 Antibody (NBP1-74272). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ACAD9 Antibody (NBP1-74272) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ACAD9 Products

Bioinformatics Tool for ACAD9 Antibody (NBP1-74272)

Discover related pathways, diseases and genes to ACAD9 Antibody (NBP1-74272). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACAD9 Antibody (NBP1-74272)

Discover more about diseases related to ACAD9 Antibody (NBP1-74272).
 

Pathways for ACAD9 Antibody (NBP1-74272)

View related products by pathway.

PTMs for ACAD9 Antibody (NBP1-74272)

Learn more about PTMs related to ACAD9 Antibody (NBP1-74272).

Blogs on ACAD9

There are no specific blogs for ACAD9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACAD9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACAD9
Uniprot