ACAD9 Antibody


Western Blot: ACAD9 Antibody [NBP1-74272] - 721_B Cell Lysate 1ug/ml Gel Concentration 12%

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

ACAD9 Antibody Summary

Synthetic peptides corresponding to the C terminal of ACAD9. Immunizing peptide sequence RSIRIGLRNHDHEVLLANTFCVEAYLQNLFSLSQLDKYAPENLDEQIKKV.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ACAD9 and was validated on Western blot.
Theoretical MW
68 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Positive Control
ACAD9 Lysate (NBP2-66172)

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ACAD9 Antibody

  • ACAD-9
  • acyl-CoA dehydrogenase family member 9, mitochondrial
  • acyl-CoA dehydrogenase family, member 9
  • acyl-Coenzyme A dehydrogenase family, member 9
  • EC 1.3.99
  • EC 1.3.99.-
  • EC
  • FLJ23533
  • MGC14452
  • NPD002


This gene encodes a member of the acyl-CoA dehydrogenase family. Members of this family of proteins localize to the mitochondria and catalyze the rate-limiting step in the beta-oxidation of fatty acyl-CoA. The encoded protein is specifically active toward palmitoyl-CoA and long-chain unsaturated substrates. Mutations in this gene cause acyl-CoA dehydrogenase family member type 9 deficiency.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, RNAi, ICC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB

Publications for ACAD9 Antibody (NBP1-74272) (0)

There are no publications for ACAD9 Antibody (NBP1-74272).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACAD9 Antibody (NBP1-74272) (0)

There are no reviews for ACAD9 Antibody (NBP1-74272). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ACAD9 Antibody (NBP1-74272) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional ACAD9 Products

Bioinformatics Tool for ACAD9 Antibody (NBP1-74272)

Discover related pathways, diseases and genes to ACAD9 Antibody (NBP1-74272). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACAD9 Antibody (NBP1-74272)

Discover more about diseases related to ACAD9 Antibody (NBP1-74272).

Pathways for ACAD9 Antibody (NBP1-74272)

View related products by pathway.

PTMs for ACAD9 Antibody (NBP1-74272)

Learn more about PTMs related to ACAD9 Antibody (NBP1-74272).

Blogs on ACAD9

There are no specific blogs for ACAD9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ACAD9 Antibody and receive a gift card or discount.


Gene Symbol ACAD9