ABR Antibody


Immunocytochemistry/ Immunofluorescence: ABR Antibody [NBP2-58211] - Staining of human cell line A-431 shows localization to cytosol.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications ICC/IF

Order Details

ABR Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LYSNFSYGTDEYDGEGNEEQKGPPEGSETMPYIDESPTMSPQLSARSQGGGDGVSPTPPEGLAPGVEAGK
Specificity of human ABR antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ABR Recombinant Protein Antigen (NBP2-58211PEP)

Reactivity Notes

Rat 86%

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for ABR Antibody

  • active BCR-related gene
  • active breakpoint cluster region-related protein
  • FLJ45954
  • MDB


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Simple Western
Species: Hu, Mu, Rt, Ch, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, B/N
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IP, CyTOF-ready
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu
Applications: ICC/IF

Publications for ABR Antibody (NBP2-58211) (0)

There are no publications for ABR Antibody (NBP2-58211).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABR Antibody (NBP2-58211) (0)

There are no reviews for ABR Antibody (NBP2-58211). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ABR Antibody (NBP2-58211) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional ABR Products

Bioinformatics Tool for ABR Antibody (NBP2-58211)

Discover related pathways, diseases and genes to ABR Antibody (NBP2-58211). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABR Antibody (NBP2-58211)

Discover more about diseases related to ABR Antibody (NBP2-58211).

Pathways for ABR Antibody (NBP2-58211)

View related products by pathway.

PTMs for ABR Antibody (NBP2-58211)

Learn more about PTMs related to ABR Antibody (NBP2-58211).

Research Areas for ABR Antibody (NBP2-58211)

Find related products by research area.

Blogs on ABR

There are no specific blogs for ABR, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ABR Antibody and receive a gift card or discount.


Gene Symbol ABR