Home » ABR » ABR Research Products » ABR Antibody

ABR Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: ABR Antibody [NBP2-58211] - Staining of human cell line A-431 shows localization to cytosol.
Immunocytochemistry/ Immunofluorescence: ABR Antibody [NBP2-58211] - Staining of human cell line A-431 shows localization to cytosol.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

ABR Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LYSNFSYGTDEYDGEGNEEQKGPPEGSETMPYIDESPTMSPQLSARSQGGGDGVSPTPPEGLAPGVEAGK
Specificity
Specificity of human ABR antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ABR
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ABR Recombinant Protein Antigen (NBP2-58211PEP)

Reactivity Notes

Rat 86%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ABR Antibody

  • active BCR-related gene
  • active breakpoint cluster region-related protein
  • FLJ45954
  • MDB

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

SGPL1 Antibody
[Unconjugated]
AF5535
Western blot shows lysates of HEK293 human embryonic kidney cell line, HepG2 human hepatocellular carcinoma cell line, HT‑29 human colon adenocarcinoma cell line, and HT‑29 tumor tissue. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human SGPL1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5535) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for SGPL1 at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Simple Western lane view shows lysates of HEK293 human embryonic kidney cell line and HepG2 human hepatocellular carcinoma cell line, loaded at 0.2 mg/mL. A specific band was detected for SGPL1 at approximately 60 kDa (as indicated) using 50 µg/mL of Goat Anti-Human SGPL1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5535) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
(5 Publications)
Species: Hu
Applications: WB, Simple Western
Mineralocorticoid
R/NR3C2 Antibody (H10 ...
NB300-562
Western Blot: Mineralocorticoid R/NR3C2 Antibody (H10E4C9F) [NB300-562] - Analysis of Mineralocorticoid Receptor.
Immunocytochemistry/Immunofluorescence: Mineralocorticoid R/NR3C2 Antibody (H10E4C9F) [NB300-562] - Mineralocorticoid Receptor staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing Mineralocorticoid Receptor at a dilution of 1:20-1:200 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
Immunohistochemistry-Paraffin: Mineralocorticoid R/NR3C2 Antibody (H10E4C9F) [NB300-562] - Both normal and cancer biopsies of deparaffinized Human colon carcinoma tissues.
(1 Publication)
Species: Hu, Mu, Rt, Ch, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, B/N
HES-1 Antibody
(OTI4H1)
NBP1-47791
Western Blot: HES-1 Antibody (OTI4H1) [NBP1-47791] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY HES1 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-HES1 (1:500).
Immunocytochemistry/Immunofluorescence: HES-1 Antibody (OTI4H1) [NBP1-47791] - HeLa cells using anti-HES1 mouse monoclonal antibody.
Immunohistochemistry-Paraffin: HES-1 Antibody (OTI4H1) [NBP1-47791] - Staining of paraffin-embedded liver using anti-Hes1 mouse monoclonal antibody.
(6 Publications)
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
HMGCL Antibody
NBP1-32767
Western Blot: HMGCL Antibody [NBP1-32767] - rat liver lysate/extract 10 % SDS-PAGE gel, antibody dilution 1:10000.
Immunocytochemistry/Immunofluorescence: HMGCL Antibody [NBP1-32767] - HeLa cells were fixed in ice-cold MeOH for 5 min. Green: HMGCL protein stained by HMGCL antibody diluted at 1:500. Blue: Hoechst 33342 staining. Scale bar = 10 um.
Immunohistochemistry-Paraffin: HMGCL Antibody [NBP1-32767] - Paraffin-embedded SW480 xenograft, using antibody at 1:500 dilution.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
LIPC Antibody
NBP3-04922
Immunocytochemistry/Immunofluorescence: LIPC Antibody [NBP3-04922] - Analysis of A549 cells using LIPC antibody. Blue: DAPI for nuclear staining.
Species: Hu
Applications: WB, ICC/IF
Exosome component
10 Antibody
NBP1-32870
Western Blot: Exosome component 10 Antibody [NBP1-32870] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with EXOSC10 antibody diluted at 1:5000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunohistochemistry-Paraffin: Exosome component 10 Antibody [NBP1-32870] - Paraffin-embedded Cal27 xenograft, using antibody at 1:100 dilution.
Western Blot: Exosome component 10 Antibody [NBP1-32870] - Sample: 1000 ug 293T whole cell lysate/extract A. 30 ug 293T whole cell lysate/extract, B. Control with 2. 5 ug of preimmune rabbit IgG, C. Immunoprecipitation of EXOSC 10 protein by 2. 5 ug of EXOSC 10 antibody 7. 5% SDS-PAGE gel.
(2 Reviews)
(3 Publications)
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
Catalase Antibody
NBP2-24916
Western Blot: Catalase Antibody [NBP2-24916] - Analysis in liver lysate of 1) human 2) mouse and 3) rat at 0.1 ug/ml.
Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-24916] - Staining of human liver tissue using an isotype control (top) and this antibody (bottom) at 5 ug/ml.
(1 Review)
(6 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Neprilysin-2/MMEL1
Antibody
AF2340
Neprilysin-2/MMEL1 Antibody
(1 Review)
Species: Hu
Applications: WB, Flow, IP, CyTOF-ready
Plexin B1 Antibody
[Unconjugated]
AF3749
Plexin B1 Antibody [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: WB, IHC
CRAT Antibody
NBP1-86616
Immunohistochemistry-Paraffin: CRAT Antibody [NBP1-86616] - Analysis in human testis and lymph node tissues. Corresponding CRAT RNA-seq data are presented for the same tissues.
Western Blot: CRAT Antibody [NBP1-86616] - Analysis using Anti-CRAT antibody NBP1-86616 (A) shows similar pattern to independent antibody NBP1-86615 (B).
Western Blot: CRAT Antibody [NBP1-86616] - Analysis in human cell line TD47D.
Species: Hu
Applications: WB, IHC, IHC-P
GLYAT Antibody
NBP2-58917
Western Blot: GLYAT Antibody [NBP2-58917] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.
Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-58917] - Staining of human skeletal muscle.
Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-58917] - Staining of human duodenum shows low expression as expected.
Species: Hu
Applications: WB, IHC, IHC-P
PMEL17/SILV
Antibody
NBP1-69571
Western Blot: PMEL17/SILV Antibody [NBP1-69571] - Sample Tissue: Human MCF7 Antibody Dilution: 1.0 ug/ml
Immunohistochemistry: PMEL17/SILV Antibody [NBP1-69571] - The inflammatory MITFlow/c-Junhigh cell state correlates with increased myeloid cell infiltration in human melanomas. Immunohistochemical analysis for gp100, CD45 and CD14 in representative cases from the Lund melanoma cohort. Small panels show zoom-in views, for example, to visualize morphology of CD45+/CD14+ tumour-infiltrating immune cells. Scale bars, 50 um. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/ncomms9755) licensed under a CC-BY licence.
Western Blot: PMEL17/SILV Antibody [NBP1-69571] - This Anti-SILV antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1.25ug/ml.
(7 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P
B3GALNT1 Antibody
NBP2-92677
Western Blot: B3GALNT1 Antibody [NBP2-92677] - Analysis of extracts of various cell lines, using B3GALNT1 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.
Immunocytochemistry/Immunofluorescence: B3GALNT1 Antibody [NBP2-92677] - Analysis of U2OS cells using B3GALNT1 at dilution of 1:100. Blue: DAPI for nuclear staining.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
PTPLA
Overexpression Lysate
NBL1-14964
Western Blot: PTPLA Overexpression Lysate (Adult Normal) [NBL1-14964] Left-Empty vector transfected control cell lysate (HEK293 cell lysate); Right -Over-expression Lysate for PTPLA.
Species: Hu
NUCKS1 Antibody
NB100-74635
Western Blot: NUCKS1 Antibody [NB100-74635] - Detection of Human NUCKS by Western Blot of Immunoprecipitates. Samples: Whole cell lysate (1 mg for IP, 20% of IP loaded) from HeLa cells. Antibodies: Affinity purified rabbit anti-NUCKS antibody NB100-74635 used for IP at 3 mcg/mg lysate. NUCKS was also immunoprecipitated by rabbit anti-NUCKS antibody NB100-74634, which recognizes an upstream epitope. Detection: Chemiluminescence with an exposure time of 30 seconds
Immunohistochemistry: NUCKS1 Antibody [NB100-74635] - Detection of human NUCKS by immunohistochemistry. Sample: FFPE section of human breast carcinoma. Antibody: Affinity purified rabbit anti- NUCKS (NB100-74635). Detection: DAB
Immunohistochemistry: NUCKS1 Antibody [NB100-74635] - Sample: FFPE section of human breast carcinoma. Antibody: Affinity purified rabbit anti- NUCKS used at a dilution of 1:1,000 (1ug/ml). Detection: DAB
Species: Hu
Applications: WB, IHC, IHC-P, IP
Protamine 1
Antibody
NBP2-30949
Immunohistochemistry-Paraffin: Protamine 1 Antibody [NBP2-30949] - Staining of human kidney shows no positivity in cells in tubules as expected.
Immunohistochemistry-Paraffin: Protamine 1 Antibody [NBP2-30949] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: Protamine 1 Antibody [NBP2-30949] - Staining of human endometrium shows no positivity in glandular cells as expected.
Species: Hu
Applications: IHC, IHC-P
Perforin Antibody
(CB5.4)
NBP1-97512
Western Blot: Perforin Antibody (CB5.4) [NBP1-97512] - Detection of perforin in the mouse T cell clone B6.1. (lane 1). Absence of perforin in the mouse fibroblast cell line NIH.3T3 (lane 2). The protein migrates as a 66 kDa species. Method: Cell extracts from the T cell clone B6.1 (2x10^6) were resolved by SDS-PAGE under reducing conditions, transferred to nitrocellulose and probed with the CB5.4 antibody at 1 ug/ml. Proteins were visualized using a peroxidase-conjugated antibody to rat IgG and a chemiluminescence detection system.
(6 Publications)
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
ABR Antibody
NBP2-58211
ABR Antibody
Species: Hu, Mu
Applications: ICC/IF

Publications for ABR Antibody (NBP2-58211) (0)

There are no publications for ABR Antibody (NBP2-58211).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABR Antibody (NBP2-58211) (0)

There are no reviews for ABR Antibody (NBP2-58211). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ABR Antibody (NBP2-58211) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional ABR Products

Bioinformatics Tool for ABR Antibody (NBP2-58211)

Discover related pathways, diseases and genes to ABR Antibody (NBP2-58211). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABR Antibody (NBP2-58211)

Discover more about diseases related to ABR Antibody (NBP2-58211).
 

Pathways for ABR Antibody (NBP2-58211)

View related products by pathway.

PTMs for ABR Antibody (NBP2-58211)

Learn more about PTMs related to ABR Antibody (NBP2-58211).
 

Research Areas for ABR Antibody (NBP2-58211)

Find related products by research area.

Blogs on ABR

There are no specific blogs for ABR, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ABR Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol ABR