ABP1/AOC1 Antibody


Western Blot: ABP1/AOC1 Antibody [NBP1-58006] - Antibody Titration: 1 ug/ml Positive control: HepG2 cell lysate.
Immunohistochemistry-Paraffin: ABP1/AOC1 Antibody [NBP1-58006] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

ABP1/AOC1 Antibody Summary

Synthetic peptides corresponding to ABP1(amiloride binding protein 1 (amine oxidase (copper-containing))) The peptide sequence was selected from the C terminal of ABP1 (NP_001082). Peptide sequence QFLHNNENIENEDLVAWVTVGFLHIPHSEDIPNTATPGNSVGFLLRPFNF.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against ABP1 and was validated on Western Blot and immunohistochemistry-paraffin
Theoretical MW
83 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Read Publication using NBP1-58006.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
0.09% Sodium Azide
Immunogen affinity purified
Reconstitution Instructions
Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution.


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ABP1/AOC1 Antibody

  • ABP
  • ABP1
  • amiloride binding protein 1 (amine oxidase (copper-containing))
  • Amiloride-binding protein
  • amiloride-sensitive amine oxidase [copper-containing]
  • amiloride-sensitive amine oxidase
  • AOC1
  • AOC1DAOamiloride-binding protein-1
  • DAO1
  • Diamine Oxidase
  • EC 1.4.3
  • EC
  • Histaminase
  • KAO
  • Kidney amine oxidase


ABP1 is a membrane glycoprotein that is expressed in many epithelium-rich and/or hematopoietic tissues and oxidatively deaminates putrescine and histamine. The protein may play a role in controlling the level of histamine and/or putrescine in these tissues. It also binds to and is inhibited by amiloride, a diuretic that acts by closing epithelial sodium ion channels.This gene encodes a membrane glycoprotein that is expressed in many epithelium-rich and/or hematopoietic tissues and oxidatively deaminates putrescine and histamine. The protein may play a role in controlling the level of histamine and/or putrescine in these tissues. It also binds to and is inhibited by amiloride, a diuretic that acts by closing epithelial sodium ion channels.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P

Publications for ABP1/AOC1 Antibody (NBP1-58006)(1)

Showing Publication 1 - 1 of 1.
Publication using NBP1-58006 Applications Species
Boomsma, F. Diabetologia 48 (5), 1002-1007. 2005 [PMID: 15830186]

Reviews for ABP1/AOC1 Antibody (NBP1-58006) (0)

There are no reviews for ABP1/AOC1 Antibody (NBP1-58006). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ABP1/AOC1 Antibody (NBP1-58006) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional ABP1/AOC1 Products

Bioinformatics Tool for ABP1/AOC1 Antibody (NBP1-58006)

Discover related pathways, diseases and genes to ABP1/AOC1 Antibody (NBP1-58006). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABP1/AOC1 Antibody (NBP1-58006)

Discover more about diseases related to ABP1/AOC1 Antibody (NBP1-58006).

Pathways for ABP1/AOC1 Antibody (NBP1-58006)

View related products by pathway.

PTMs for ABP1/AOC1 Antibody (NBP1-58006)

Learn more about PTMs related to ABP1/AOC1 Antibody (NBP1-58006).

Blogs on ABP1/AOC1

There are no specific blogs for ABP1/AOC1, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ABP1/AOC1 Antibody and receive a gift card or discount.


Gene Symbol AOC1
Novus 100% Guarantee