ABP1/AOC1 Antibody - BSA Free

Western Blot: ABP1/AOC1 Antibody [NBP1-58006] - Antibody Titration: 1 ug/ml Positive control: HepG2 cell lysate.

Immunohistochemistry-Paraffin: ABP1/AOC1 Antibody [NBP1-58006] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ABP1/AOC1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to ABP1(amiloride binding protein 1 (amine oxidase (copper-containing))) The peptide sequence was selected from the C terminal of ABP1 (NP_001082). Peptide sequence QFLHNNENIENEDLVAWVTVGFLHIPHSEDIPNTATPGNSVGFLLRPFNF. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AOC1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
• Theoretical MW: 83 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ABP1/AOC1 Antibody - BSA Free

• ABP
• ABP1
• amiloride binding protein 1 (amine oxidase (copper-containing))
• Amiloride-binding protein
• amiloride-sensitive amine oxidase [copper-containing]
• amiloride-sensitive amine oxidase
• AOC1
• AOC1DAOamiloride-binding protein-1
• DAO1
• Diamine Oxidase
• EC 1.4.3
• EC 1.4.3.22
• Histaminase
• KAO
• Kidney amine oxidase

Background

ABP1 is a membrane glycoprotein that is expressed in many epithelium-rich and/or hematopoietic tissues and oxidatively deaminates putrescine and histamine. The protein may play a role in controlling the level of histamine and/or putrescine in these tissues. It also binds to and is inhibited by amiloride, a diuretic that acts by closing epithelial sodium ion channels.This gene encodes a membrane glycoprotein that is expressed in many epithelium-rich and/or hematopoietic tissues and oxidatively deaminates putrescine and histamine. The protein may play a role in controlling the level of histamine and/or putrescine in these tissues. It also binds to and is inhibited by amiloride, a diuretic that acts by closing epithelial sodium ion channels.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ABP1/AOC1 Antibody (NBP1-58006)(2)

Publications using NBP1-58006

• Kwak H, Koh W, Kim S et al. Astrocytes Control Sensory Acuity via Tonic Inhibition in the Thalamus Neuron 2020-08-30 [PMID: 32905785]
• Boomsma, F. Diabetologia 48 (5), 1002-1007. 2005-01-01 [PMID: 15830186]

Bioinformatics

• Gene Symbol: AOC1
• Entrez:
  • 26(Human)
  • 76507(Mouse)
  • 65029(Rat)
• Uniprot:
  • P19801(Human)