Abhd5 Antibody

Images

 
Western Blot: Abhd5 Antibody [NBP1-84507] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: Abhd5 Antibody [NBP1-84507] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Abhd5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MTIPYGWAKRPMLQRIGKMHPDIPVSVIFGARSCIDGNSGTSIQSLRPHSYVKTIAILGAGHYVYADQPEEFNQKVKEI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ABHD5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Abhd5 Protein (NBP1-84507PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Abhd5 Antibody

  • abhydrolase domain containing 5
  • Abhydrolase domain-containing protein 5,1-acylglycerol-3-phosphate O-acyltransferase ABHD5
  • CDS
  • CGI58
  • EC 2.3.1.51
  • IECN2
  • Lipid droplet-binding protein CGI-58
  • MGC8731
  • NCIE2CGI-58

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-41536
Species: Hu, Mu
Applications: WB, ICC/IF
NB110-37253
Species: Hu, Mu, Rt
Applications: WB
NB110-40760
Species: Hu, Mu, Rt, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NB110-40877
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-54155
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB110-60509
Species: Hu, Mu, Bv
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NB100-1269
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-82236
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-71690
Species: Hu
Applications: ICC/IF
NBP1-85691
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-00227
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-49233
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83950
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84507
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Abhd5 Antibody (NBP1-84507) (0)

There are no publications for Abhd5 Antibody (NBP1-84507).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Abhd5 Antibody (NBP1-84507) (0)

There are no reviews for Abhd5 Antibody (NBP1-84507). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Abhd5 Antibody (NBP1-84507) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Abhd5 Products

Bioinformatics Tool for Abhd5 Antibody (NBP1-84507)

Discover related pathways, diseases and genes to Abhd5 Antibody (NBP1-84507). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Abhd5 Antibody (NBP1-84507)

Discover more about diseases related to Abhd5 Antibody (NBP1-84507).
 

Pathways for Abhd5 Antibody (NBP1-84507)

View related products by pathway.

PTMs for Abhd5 Antibody (NBP1-84507)

Learn more about PTMs related to Abhd5 Antibody (NBP1-84507).
 

Research Areas for Abhd5 Antibody (NBP1-84507)

Find related products by research area.

Blogs on Abhd5

There are no specific blogs for Abhd5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Abhd5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ABHD5