Abhd5 Antibody - BSA Free

Western Blot: Abhd5 Antibody [NBP1-84506] - Analysis in control (vector only transfected HEK293T lysate) and ABHD5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: Abhd5 Antibody [NBP1-84506] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol & vesicles.

Immunohistochemistry-Paraffin: Abhd5 Antibody [NBP1-84506] - Staining of human tonsil shows moderate cytoplasmic positivity in germinal center cells.

Immunohistochemistry-Paraffin: Abhd5 Antibody [NBP1-84506] - Staining of human cerebral cortex shows weak cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: Abhd5 Antibody [NBP1-84506] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.

Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Abhd5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Abhd5 Antibody - BSA Free (NBP1-84506) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MAAEEEEVDSADTGERSGWLTGWLPTWCPTSISHLKEAEEKMLKCVPCTYKKEPVRISNGNKIWTLKFSHNISNKTPLVLLHG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ABHD5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Abhd5 Protein (NBP1-84506PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (87%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Abhd5 Antibody - BSA Free

• abhydrolase domain containing 5
• Abhydrolase domain-containing protein 5,1-acylglycerol-3-phosphate O-acyltransferase ABHD5
• CDS
• CGI58
• EC 2.3.1.51
• IECN2
• Lipid droplet-binding protein CGI-58
• MGC8731
• NCIE2CGI-58

Background

Abhydrolase domain containing 5 (ABHD5) belongs to a very large protein family which contains an alpha/beta hydrolase fold. ABHD5 also contains three sequence motifs that correspond to a catalytic triad found in the esterase/lipase/thioesterase subfamily. Abhd 5 is distinct from other members of this subfamily because the putative catalytic triad contains an asparagine rather than a serine residue.

ABHD5 is a lysophosphatidic acid acyltransferase with a role in phosphatidic acid biosynthesis. ABHD5 may also help regulate cellular storage of triacylglycerol by activating the phospholipase PNPLA2. Additionaly, the ABHD5 protein is thought to play a role in keratinocyte differentiation.

Mutations in this gene are associated with Chanarin-Dorfman syndrome, a triglyceride storage disease characterized by impaired oxidation of long-chain fatty acids. Abhd5 is expressed in many tissues, including brain, liver, skin, skeletal muscle and lymphocytes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ABHD5