ABCE1 Antibody (1N4I7)

Western Blot: ABCE1 Antibody (1N4I7) [NBP3-16763] - Western blot analysis of extracts of various cell lines, using ABCE1 Rabbit mAb (NBP3-16763) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.

Immunocytochemistry/ Immunofluorescence: ABCE1 Antibody (1N4I7) [NBP3-16763] - Immunofluorescence analysis of NIH-3T3 cells using ABCE1 Rabbit mAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, ICC/IF
• Clone: 1N4I7
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

ABCE1 Antibody (1N4I7) Summary

• Description: Novus Biologicals Rabbit ABCE1 Antibody (1N4I7) (NBP3-16763) is a recombinant monoclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 500-599 of human ABCE1 ( NP_002931.2). AARVVKRFILHAKKTAFVVEHDFIMATYLADRVIVFDGVPSKNTVANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIKDVEQKKSGNYFFLDD
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: ABCE1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 67 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ABCE1 Antibody (1N4I7)

• 2'-5'-oligoadenylate-binding protein
• ATP-binding cassette, sub-family E (OABP), member 1
• huHP68
• OABP
• Ribonuclease 4 inhibitor
• ribonuclease L (2'-5'-oligoisoadenylate synthetase-dependent) inhibitor
• RLIABC38
• RNase L inhibitor
• RNASEL1
• RNASELIRNS4IATP-binding cassette sub-family E member 1

Background

ATP-binding cassette sub-family E member 1 (ABCE1) is a member of the ATP-binding cassette sub-family E, but is not a membrane transporter.

ABCE-1 interacts with RNASEL to inhibit its endoribonuclease activity, and antagonizes the anti-viral effect of the interferon-regulated 2-5A/RNase L pathway. ABCE1 is activated by encephalomyocarditis virus (EMCV) and HIV-1, and recently it has been found to be essential for the assembly of immature immunodeficiency virus capsids.

ABCE1 antibodies are useful tools for HIV studies and research on the ATP-binding cassette families.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ABCE1