ABCC12 Antibody

Images

 
Western Blot: ABCC12 Antibody [NBP1-69063] - Mouse Spleen lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ABCC12 Antibody Summary

Immunogen
Synthetic peptides corresponding to Abcc12 (ATP-binding cassette, sub-family C (CFTR/MRP), member 12) The peptide sequence was selected from the middle region of Abcc12. Peptide sequence NILFGEKYNHQRYQHTVHVCGLQKDLNSLPYGDLTEIGERGVNLSGGQRQ.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
Abcc12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Abcc12 and was validated on Western blot.
Theoretical MW
153 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ABCC12 Antibody

  • ATP-binding cassette transporter sub-family C member 12
  • ATP-binding cassette, sub-family C (CFTR/MRP), member 12
  • MGC27071
  • MRP9ATP-binding cassette sub-family C member 12
  • multidrug resistance-associated protein 9

Background

Abcc12 is a probable transporter.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NBP1-82623
Species: Hu
Applications: IHC, IHC-P
NB100-94881
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-1471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP2-59320
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC
NBP2-48743
Species: Hu
Applications: IHC, IHC-P
NBP1-42342
Species: Hu
Applications: WB, Flow, IHC, IHC-Fr
NBP2-37923
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF3059
Species: Mu
Applications: WB, Simple Western, ICC
NBP1-42349
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-556
Species: Hu
Applications: WB, IP
NBP2-19417
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57299
Species: Hu
Applications: WB, ICC/IF, IHC-P
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-38160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-76670
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-46466
Species: Hu
Applications: IHC

Publications for ABCC12 Antibody (NBP1-69063) (0)

There are no publications for ABCC12 Antibody (NBP1-69063).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABCC12 Antibody (NBP1-69063) (0)

There are no reviews for ABCC12 Antibody (NBP1-69063). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ABCC12 Antibody (NBP1-69063) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ABCC12 Products

Bioinformatics Tool for ABCC12 Antibody (NBP1-69063)

Discover related pathways, diseases and genes to ABCC12 Antibody (NBP1-69063). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABCC12 Antibody (NBP1-69063)

Discover more about diseases related to ABCC12 Antibody (NBP1-69063).
 

Pathways for ABCC12 Antibody (NBP1-69063)

View related products by pathway.

Blogs on ABCC12

There are no specific blogs for ABCC12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ABCC12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol Abcc12
Uniprot