ABCC11 Antibody


Western Blot: ABCC11 Antibody [NBP1-59810] - NCI-H226 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

ABCC11 Antibody Summary

Synthetic peptides corresponding to ABCC11(ATP-binding cassette, sub-family C (CFTR/MRP), member 11) The peptide sequence was selected from the middle region of ABCC11. Peptide sequence NSKIILIDEATASIDMETDTLIQRTIREAFQGCTVLVIAHRVTTVLNCDH.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ABCC11 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ABCC11 Antibody

  • ATP-binding cassette protein C11
  • ATP-binding cassette transporter MRP8
  • ATP-binding cassette transporter sub-family C member 11
  • ATP-binding cassette, sub-family C (CFTR/MRP), member 11
  • EWWD
  • MRP8ATP-binding cassette sub-family C member 11
  • Multidrug resistance-associated protein 8
  • multi-resistance protein 8
  • WW


The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, M


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Applications: WB, Simple Western, IHC, ICC
Species: Mu
Applications: WB, Simple Western, ICC
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Dr
Applications: WB, Simple Western, ChIP, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ABCC11 Antibody (NBP1-59810) (0)

There are no publications for ABCC11 Antibody (NBP1-59810).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABCC11 Antibody (NBP1-59810) (0)

There are no reviews for ABCC11 Antibody (NBP1-59810). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ABCC11 Antibody (NBP1-59810) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for ABCC11 Antibody (NBP1-59810)

Discover related pathways, diseases and genes to ABCC11 Antibody (NBP1-59810). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABCC11 Antibody (NBP1-59810)

Discover more about diseases related to ABCC11 Antibody (NBP1-59810).

Pathways for ABCC11 Antibody (NBP1-59810)

View related products by pathway.

PTMs for ABCC11 Antibody (NBP1-59810)

Learn more about PTMs related to ABCC11 Antibody (NBP1-59810).

Blogs on ABCC11

There are no specific blogs for ABCC11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ABCC11 Antibody and receive a gift card or discount.


Gene Symbol ABCC11