We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

ABCA7 Recombinant Protein Antigen

Images

 
There are currently no images for ABCA7 Recombinant Protein Antigen (NBP2-14250PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ABCA7 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ABCA7.

Source: E. coli

Amino Acid Sequence: VNRTFEELTLLRDVREVWEMLGPRIFTFMNDSSNVAMLQRLLQMQDEGRRQPRPGGRDHMEALRSFLDPGSGGYSWQDAHADVGHL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ABCA7
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-14250.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ABCA7 Recombinant Protein Antigen

  • ABCA-SSN
  • ABCXATP-binding cassette sub-family A member 7
  • ATP-binding cassette, sub-family A (ABC1), member 7
  • Autoantigen SS-N
  • EC 2.2.1.1
  • EC 3.6.3
  • EC 3.6.3.41
  • FLJ40025
  • Macrophage ABC transporter

Background

ATP-binding cassette sub-family A member 7 (ABCA7), is a member of the ATP-binding cassette sub-family A. ABCA7 is thought to have a role in phagocytosis apoptotic cells macrophages.

ABCA-7 is highly homologous to ABCA1, and also mediates cellular cholesterol and phospholipid release by apolipoproteins. The ABCA7 gene is regulated by sterol in the opposite direction to ABCA1 through SRE/SREBP2. The expression of ABCA7 by this regulation is associated with phagocytic activity. As well, it binds APOA1 and may function in apolipoprotein-mediated phospholipid efflux from cells. It also may mediate cholesterol efflux.

ABCA7 antibodies are useful for studies of cholesterol formation and lipid processing mechanisms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-105
Species: Ca, Ch, ChHa, Eq, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, ChIP, ChIP, Dual ISH-IHC, ELISA, Flow, GS, GS, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, PCR, Simple Western, WB
NBP3-41339
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-52979
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IP, WB
AF2747
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
NBP2-22377
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-30032
Species: Bv, Ca, Fe, Hu, Mu, Xp
Applications: ICC/IF, IHC, IHC-Fr, KO, WB
NBP1-86658
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF638
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, WB
NB400-132
Species: ChHa, Ha, Hu, Pm, Mu, Rb, Rt
Applications: Flow-IC, Flow, IB, ICC/IF, IHC,  IHC-P, IP, In vitro, In vivo, Simple Western, WB
NBP1-90625
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB400-156
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IP, Simple Western, WB
NBP1-89102
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-20863
Species: Hu
Applications: IHC,  IHC-P, IP, PEP-ELISA, WB
NBP1-89310
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-29460
Species: Pm, Pm-Cm, Hu, Pm, RM
Applications: Flow, ICC/IF, IHC,  IHC-P, ISH
NBP1-80712
Species: Hu
Applications: ICC/IF
NBP2-82106
Species: Hu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-14250PEP
Species: Hu
Applications: AC

Publications for ABCA7 Recombinant Protein Antigen (NBP2-14250PEP) (0)

There are no publications for ABCA7 Recombinant Protein Antigen (NBP2-14250PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABCA7 Recombinant Protein Antigen (NBP2-14250PEP) (0)

There are no reviews for ABCA7 Recombinant Protein Antigen (NBP2-14250PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ABCA7 Recombinant Protein Antigen (NBP2-14250PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ABCA7 Products

Array NBP2-14250PEP

Research Areas for ABCA7 Recombinant Protein Antigen (NBP2-14250PEP)

Find related products by research area.

Blogs on ABCA7

There are no specific blogs for ABCA7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ABCA7 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ABCA7