ABCA5 Antibody

Images

 
Immunohistochemistry-Paraffin: ABCA5 Antibody [NBP1-84780] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ABCA5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PNKKYEEVPNIELNPMDKFTLSNLILGYTPVTNITSSIMQKVSTDHLPDVIITEEYTNEKEMLTSSLSKPSNFV
Specificity
Specificity of human ABCA5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ABCA5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%), Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ABCA5 Antibody

  • ABC13
  • ATP-binding cassette A5
  • ATP-binding cassette sub-family A member 5
  • ATP-binding cassette, sub-family A (ABC1), member 5
  • DKFZp451F117
  • DKFZp779N2435
  • EC 3.6.3
  • EC 3.6.3.25
  • EC 3.6.3.41
  • EST90625
  • FLJ16381
  • KIAA1888

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-58327
Species: Hu, Mu
Applications: WB, ICC/IF
NB100-80870
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ELISA, IHC, IHC-P
H00023460-Q01
Species: Hu
NBP1-20863
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-2379
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, Flow, ICC/IF, IHC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-93469
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-91641
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB400-163
Species: Mu
Applications: WB, Flow, IHC, IHC-P
NB400-105
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Eq, Ha, Md, Pm, Rb
Applications: WB, Simple Western, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, Dual ISH-IHC, GS, KD, PCR
NBP1-77687
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30032
Species: Hu, Mu, Bv, Ca, Xp
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NB100-56098
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
NB400-132
Species: Hu, Mu, Rt, ChHa, Ha, Mk, Rb
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-P, In vitro, Flow-IC
NBP2-66958
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-67360
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for ABCA5 Antibody (NBP1-84780) (0)

There are no publications for ABCA5 Antibody (NBP1-84780).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABCA5 Antibody (NBP1-84780) (0)

There are no reviews for ABCA5 Antibody (NBP1-84780). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ABCA5 Antibody (NBP1-84780) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ABCA5 Products

Array NBP1-84780

Bioinformatics Tool for ABCA5 Antibody (NBP1-84780)

Discover related pathways, diseases and genes to ABCA5 Antibody (NBP1-84780). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABCA5 Antibody (NBP1-84780)

Discover more about diseases related to ABCA5 Antibody (NBP1-84780).
 

Pathways for ABCA5 Antibody (NBP1-84780)

View related products by pathway.

Research Areas for ABCA5 Antibody (NBP1-84780)

Find related products by research area.

Blogs on ABCA5

There are no specific blogs for ABCA5, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ABCA5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ABCA5
Entrez
Uniprot
Novus 100% Guarantee