ABCA5 Antibody - BSA Free

Immunohistochemistry-Paraffin: ABCA5 Antibody [NBP1-84780] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ABCA5 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PNKKYEEVPNIELNPMDKFTLSNLILGYTPVTNITSSIMQKVSTDHLPDVIITEEYTNEKEMLTSSLSKPSNFV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ABCA5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ABCA5 Protein (NBP1-84780PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (81%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ABCA5 Antibody - BSA Free

• ABC13
• ATP-binding cassette A5
• ATP-binding cassette sub-family A member 5
• ATP-binding cassette, sub-family A (ABC1), member 5
• DKFZp451F117
• DKFZp779N2435
• EC 3.6.3
• EC 3.6.3.25
• EC 3.6.3.41
• EST90625
• FLJ16381
• KIAA1888

Background

ABCA5 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). ABCA5 is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. ABCA5 is clustered among 4 other ABC1 family members on 17q24, but neither the substrate nor the function of this gene is known. Alternative splicing of ABCA5 results in several transcript variants; however, not all variants have been fully described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ABCA5
• Entrez:
  • 23461(Human)
• Uniprot:
  • Q8WWZ7(Human)