ABCA13 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ABCA13 Antibody [NBP2-57346] - Staining of human cell line PC-3 shows localization to nucleoplasm, cytosol & vesicles.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ABCA13 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DWLPLNQTFSQVSELVLNVTISTLTFLQQHGVAVTEPVYHLSMQNIVWDPQKVQYDLKSQFGFDDLHTEQILNSSAELKEIPTDTSLEKMVCSV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ABCA13
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ABCA13 Recombinant Protein Antigen (NBP2-57346PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ABCA13 Antibody - BSA Free

• ABCA13
• ATP binding cassette transporter A13
• ATP-binding cassette sub-family A member 13
• ATP-binding cassette, sub-family A (ABC1), member 13
• DKFZp313D2411
• EC 2.7.11.25
• EC 3.6.3
• FLJ16398
• FLJ33876
• FLJ33951

Background

In human, the ATP-binding cassette (ABC) family of transmembrane transporters has at least 48 genes and 7 genesubfamilies. This gene is a member of ABC gene subfamily A (ABCA). Genes within the ABCA family typically encodeseveral thousand amino acids. Like other ABC transmembrane transporter proteins, this protein has 12 or moretransmembrane alpha-helix domains that likely arrange to form a single central chamber with multiple substrate bindingsites. It is also predicted to have two large extracellular domains and two nucleotide binding domains as is typicalfor ABCA proteins. Alternative splice variants have been described but their biological validity has not beendemonstrated.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ABCA13