ABCA13 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ABCA13 Antibody [NBP2-57346] - Staining of human cell line PC-3 shows localization to nucleoplasm, cytosol & vesicles.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ABCA13 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DWLPLNQTFSQVSELVLNVTISTLTFLQQHGVAVTEPVYHLSMQNIVWDPQKVQYDLKSQFGFDDLHTEQILNSSAELKEIPTDTSLEKMVCSV
Specificity
Specificity of human ABCA13 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ABCA13
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ABCA13 Recombinant Protein Antigen (NBP2-57346PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ABCA13 Antibody

  • ATP binding cassette transporter A13
  • ATP-binding cassette sub-family A member 13
  • ATP-binding cassette, sub-family A (ABC1), member 13
  • DKFZp313D2411
  • EC 2.7.11.25
  • EC 3.6.3
  • FLJ16398
  • FLJ33876
  • FLJ33951

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-58327
Species: Hu
Applications: WB, ICC/IF
NB400-105
Species: Hu, Mu, Rt, Po, Ca, Ch, Ha, Md
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, GS
NB100-93466
Species: Hu, Mu
Applications: ICC/IF, IP, PEP-ELISA
NBP1-30032
Species: Hu, Mu, Bv, Xp
Applications: WB, IHC, IHC-Fr
NBP2-30876
Species: Hu
Applications: IHC, IHC-P
NBP2-52979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB400-166
Species: Mu
Applications: WB, Flow, IHC-P
NBP2-21601
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82623
Species: Hu
Applications: IHC, IHC-P
NBP1-89310
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-80870
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ELISA, IHC, IHC-P
NBP1-20863
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-77687
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-89314
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-66958
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-31824
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-71706
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-42342
Species: Hu
Applications: WB, Flow, IHC, IHC-Fr
NBP2-23488
Species: Hu
Applications: ICC/IF (-), WB, ELISA, Flow, IHC, IHC-P

Publications for ABCA13 Antibody (NBP2-57346) (0)

There are no publications for ABCA13 Antibody (NBP2-57346).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABCA13 Antibody (NBP2-57346) (0)

There are no reviews for ABCA13 Antibody (NBP2-57346). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ABCA13 Antibody (NBP2-57346) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for ABCA13 Antibody (NBP2-57346)

Discover related pathways, diseases and genes to ABCA13 Antibody (NBP2-57346). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABCA13 Antibody (NBP2-57346)

Discover more about diseases related to ABCA13 Antibody (NBP2-57346).
 

Pathways for ABCA13 Antibody (NBP2-57346)

View related products by pathway.

Blogs on ABCA13

There are no specific blogs for ABCA13, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ABCA13 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ABCA13