AATF Antibody

Images

 
Immunohistochemistry-Paraffin: AATF Antibody [NBP1-85634] - Staining of human cerebral cortex shows strong nuclear and cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AATF Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SVQSISDFEKFTKGMDDLGSSEEEEDEESGMEEGDDAEDSQGESEEDRAGDRNSEDDGVVMTFSSVKVSEEVEKGRAVKNQIALWDQLLEGRIKLQKALLTTNQLPQPDVFPLFKDKGGPEFSSALKNSHKALKALLTSLVGLQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AATF
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
AATF Protein (NBP1-85634PEP)
Publications
Read Publication using NBP1-85634.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AATF Antibody

  • apoptosis antagonizing transcription factor
  • Apoptosis-antagonizing transcription factor
  • CHE-1
  • CHE1Rb-binding protein Che-1
  • DEDprotein AATF

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-81831
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-77020
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF9024
Species: Mu, Rt
Applications: WB, IHC
AF5588
Species: Hu, Mu
Applications: WB, IHC
NBP1-76962
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, ICC
NB100-56118
Species: Hu, Mu, Rt, Ca, Ge
Applications: IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-31686
Species: Hu
Applications: WB, ICC/IF
NB100-56123
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-56546
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NB300-581
Species: Hu, Mu, Rt, Po, Am, Ca, GP, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, IF
NBP1-85634
Species: Hu
Applications: IHC, IHC-P

Publications for AATF Antibody (NBP1-85634)(1)


Reviews for AATF Antibody (NBP1-85634) (0)

There are no reviews for AATF Antibody (NBP1-85634). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for AATF Antibody (NBP1-85634) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AATF Products

Bioinformatics Tool for AATF Antibody (NBP1-85634)

Discover related pathways, diseases and genes to AATF Antibody (NBP1-85634). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AATF Antibody (NBP1-85634)

Discover more about diseases related to AATF Antibody (NBP1-85634).
 

Pathways for AATF Antibody (NBP1-85634)

View related products by pathway.

PTMs for AATF Antibody (NBP1-85634)

Learn more about PTMs related to AATF Antibody (NBP1-85634).
 

Research Areas for AATF Antibody (NBP1-85634)

Find related products by research area.

Blogs on AATF

There are no specific blogs for AATF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AATF Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AATF